KEGG   Flavobacteriaceae bacterium: FIC_00013Help
Entry
FIC_00013         CDS       T00953                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FIC_00013
Enzymes [BR:fba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FIC_00013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12247..12921
Genome map
AA seq 224 aa AA seqDB search
MKILFTKKFNKMMISKKLGSHFSYDFVEVIAITPMEVEAFNLKDQSLIFTSVNAVRSFFK
NGFEPDENFASKNYNKIYTVGITTKRELRKFGFGTFKVTKHAKELSEFIIENSSKEKFLH
FCGNLALDVLNKTLPLQNVSYRKIPVYETTLLYPQIAGNYDAVCFFSPSGVRSFAKFNSF
ENLAIFSIGETTANELKKFTQNPIITSKESNLDDLLKLISDHLS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaagattctgttcacaaaaaaattcaataaaatgatgatttccaagaaattagggagt
catttttcttatgattttgtggaggttattgccatcacgccgatggaggtggaggctttt
aaccttaaggatcagtcgcttattttcacaagcgttaatgcggtgcgaagtttcttcaaa
aacggttttgagcccgacgaaaatttcgccagcaaaaattataataagatttacactgtg
ggcatcaccacaaaaagagaactgaggaagttcggattcggaacttttaaggtgaccaaa
catgccaaagaactttcagaattcatcatcgaaaacagctccaaagagaaatttctgcac
ttttgcgggaatcttgcgctggatgtgctgaacaaaaccctgccgcttcaaaatgtttcg
taccgcaagattccggtgtacgaaaccacgctgctttatccccagatcgcgggaaattat
gacgcagtgtgtttttttagtccgagtggagttcgtagttttgcgaagttcaattcattt
gaaaaccttgcgatattttcaattggcgaaaccaccgcaaacgaacttaaaaaattcacc
caaaaccctataattaccagtaaagaaagcaatcttgatgatttgttgaagttaatttcc
gatcatttatcatga

DBGET integrated database retrieval system