KEGG   Flavobacteriaceae bacterium: FIC_00308Help
Entry
FIC_00308         CDS       T00953                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FIC_00308
Enzymes [BR:fba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FIC_00308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(308560..309123)
Genome map
AA seq 187 aa AA seqDB search
MNKVLIFSAPSGSGKTTLVKHCLEVFPELSFSVSCTTRSPRGSEVDGIDYHFITPDQFRA
KIAEDAFVEFEEVYEDKYYGTLKSEVDKIWSSGKVVIFDVDVKGGISLKKYFADQALSIF
IMPPSIEELERRLISRATDDADTIATRVEKAAEEMTYVNQFDVTVVNTDLDEAKKETEQI
IKQFIRS
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtcctaatattttcagcaccttccggaagtggcaaaactaccttggtaaaa
cactgtctggaggtttttcccgaactgagtttttcggtttcatgcactacacgaagcccg
cgcggcagcgaagtggatggcatcgattatcattttataactccggatcaattcagggcg
aaaattgccgaagacgcattcgtagaatttgaggaggtttacgaggacaaatattacgga
accctcaaatctgaagtggataaaatctggagtagcggcaaggttgtgattttcgatgta
gacgtaaaaggtgggatttcccttaaaaaatattttgcagatcaggcgctttcaatcttt
ataatgccgccctccatcgaagaactcgagcgtcgcttaatttcccgtgctaccgatgat
gctgatacaattgccacgcgcgtggaaaaagccgccgaagaaatgacttacgtaaatcag
tttgacgtaacagtagttaatacagatctggacgaggccaaaaaagaaacggaacagatc
attaagcaattcatccgctcatga

DBGET integrated database retrieval system