KEGG   Flavobacteriaceae bacterium: FIC_00395Help
Entry
FIC_00395         CDS       T00953                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fba00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FIC_00395
Enzymes [BR:fba01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     FIC_00395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
396583..397350
Genome map
AA seq 255 aa AA seqDB search
MDRHLYFLCKIKVFLFMVKAFANVNQNFIVRIPPQQTTRCAPEIARFCLFKNFIFGYLKK
HMIYSLKGNVQELNPTSVIIDVNGVGYYVGVSLQTSEKLVLGKETFLNIQQIIREDAHLL
FGFNTISEKELFNLLISVNGVGPVSALIMLSSLSLQEIASAILSGNSLLLQKVKGIGTKT
AERIIVDLRDKVQKFNISEGNISNFVNNKVKDEALSALEVLGIPKKMSEKIADRFLKTNA
DLSVEDLVKQILKNI
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtggatagacatctttactttctgtgcaaaattaaggtatttttatttatggtgaaagcc
tttgcaaatgtgaatcaaaattttatagttcggattccgccacagcaaaccacgcgctgc
gcgcccgaaattgcccgattttgtttgtttaaaaattttatctttggatatcttaaaaaa
cacatgatctactcactaaaaggaaacgtccaggaactgaaccctacttctgtaattatc
gatgtgaacggtgttggctactatgtcggcgtcagtttgcagacttctgaaaaactcgtt
ttaggcaaagaaacgtttcttaacatccaacagattatccgcgaagacgctcacctgctc
tttggttttaacacaatttccgaaaaagaactgtttaacctgttaatttctgttaacggc
gtcggacccgtttctgccctcattatgctgtcttcgctcagccttcaggagatcgcttcg
gccatcctcagcggcaatagtttgctgttgcagaaagtgaagggtatcggcaccaaaaca
gccgagcgcatcatcgtcgatctgcgggataaagtgcagaaattcaatatttccgaggga
aatatttctaactttgtgaataataaagtgaaggacgaagcgttatctgcattagaggtt
ttgggcatccccaaaaaaatgagtgagaagattgccgaccgtttccttaagaccaatgcc
gacctttccgtagaagatttagtgaagcaaattttaaaaaatatttaa

DBGET integrated database retrieval system