KEGG   Flavobacteriaceae bacterium: FIC_00397Help
Entry
FIC_00397         CDS       T00953                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FIC_00397
Enzymes [BR:fba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FIC_00397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404581..405246
Genome map
AA seq 221 aa AA seqDB search
MNQEIDNDDDVFTGKDHTPLRDDAFAKSTDEKIEIIQHHFHQIMETLGMDMTDDSLKDSP
KRVARMYVNEIFGGLLPENMPRISTFSNKYKYRQMLVEKDITVYSFCEHHFLPIIGRAHV
AYISNGEVIGLSKINRIVDYYARRPQVQERLTMQIVDALKSALGTKDVACIIDAKHLCVN
CRGIRDTASSTITAELSGIFRTNPITRQEFLHYVGSHAKLD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggaaatcgataacgacgacgatgtatttaccgggaaagaccatacaccgctg
cgtgatgatgctttcgcgaaatcaaccgacgaaaaaatagaaatcattcagcatcatttt
catcagattatggagaccttaggcatggatatgacggatgattcactgaaagattctcca
aaacgcgtcgcgaggatgtacgtgaatgaaattttcggcggccttttacccgaaaatatg
ccgcggatttcaacattttcgaataaatacaaataccggcagatgctggttgaaaaagac
atcacggtgtattcgttctgcgagcaccattttctgccgattattggccgcgcacatgtt
gcctatatctcgaatggcgaagtgatcggcctttctaaaataaaccggatcgtcgattat
tatgcgcgacgtccgcaggttcaggaaagactcacgatgcagatcgtggacgctttgaaa
tcggccttgggtacaaaagacgtggcctgcattattgatgcgaaacatctgtgtgtgaat
tgtcgtggcatcagggatacggcaagttctaccattactgcagagcttagcggaattttc
agaacaaatccgattacgagacaggagtttctgcattatgtgggaagccacgcgaaactc
gattag

DBGET integrated database retrieval system