KEGG   Flavobacteriaceae bacterium: FIC_00399Help
Entry
FIC_00399         CDS       T00953                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FIC_00399
Enzymes [BR:fba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     FIC_00399
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
407009..409663
Genome map
AA seq 884 aa AA seqDB search
MKLFFSINFRTKVGENLQLLIIKNQNVEKSCPLTYSKDGNWVAEVDYFSRDITYKYRLTD
DSGTILDEEFAVHRLDFPYQYDEFIIHDTWNLKNFPENYLNNKILKNKLSGFKPEKVSVL
KKHTHLFRLEAPIYQKNWQIVMLGDHDALGNWEYFKAVPMAQTDFGVWEAALELPANQII
HYKYGLRNSDTGEVFDIEYGENRWATPNTEKNVLQIKADHYFRFKAFEMYHAAGVAVPVF
ALRTENGFGVGEFNDLKNLADWAKETNLSVLQILPINDTTANYTWTDSYPYAAISVYALH
PQYLSLEKLDFAIPEDLLEQFNMEKTELNSLSLIDYEKMISAKWKYITAVFNLNKDEILK
DRNFRKFLKENDEWLLPYAAFCVQRDKYKTPDFNSWKTHKKYIPGKIAPFFTAKSKDFST
TMLHAWVQYQLHVQLKEAIDYTHELGISVKGDLPIGIYRHSVEAWTEPDLFGMDFQAGAP
PDQFTELGQNWEFPTYNWEAMKADGYRWWKNRFKALEQYFDAMRIDHILGFFRIWRMPVS
ATQGLLGYFYPAVPVTADEFRSRNIPFNEDRYCKPFINDQILWDEFGMERDAIHNHFMNN
HFNGIYTFKEEFDTQRKLTDYFKQNPYGWAEEKLISLCANVLFLIEEKDGEGVYHPRFNV
SRTTSYQYLPDWERAAINDLYNDYFFKRQDGLWYQKAMEKLPVILNATDMLICGEDLGFV
PESVPVVMDRLAITALKVQRMPSDDVAWYNPKEAGYMNVVTASSHDSSTLRQWWHEDRNL
TQQYFRDQLGQAGTAPHNLEPQLAEMIMKQHLYNDAMLAIFPIQEFLATDPALTRAEMDE
ERINQPAVFPHYWRYRMHLNLENLLDKGDFNNKIAGWVADSNRM
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctttttcagcattaacttcagaactaaagtaggagaaaaccttcagcttttg
atcattaaaaaccaaaacgtagaaaagagctgtccgcttacttattcgaaggatggaaac
tgggtagccgaagtcgattatttttcacgggacattacctacaaatacaggctgaccgat
gattccggtactattctcgatgaagaatttgccgttcaccgtctggactttccttatcag
tacgatgagtttataatccacgatacctggaacctcaagaatttccctgaaaattacctc
aataataagattctcaagaacaaattaagcggtttcaaacccgaaaaagtttcagtactg
aagaaacacacgcatcttttccggcttgaggccccaatatatcagaaaaattggcagatc
gtgatgctcggcgatcatgatgcgcttggcaactgggagtatttcaaggcggtacctatg
gcgcagaccgattttggggtgtgggaagcggcgcttgaattgccggcaaaccaaatcatt
cactacaaatacggcttgcggaattccgatactggtgaggttttcgatatagaatatggc
gaaaaccgctgggccacgccgaacaccgagaagaatgttctgcagatcaaggccgatcat
tatttcaggtttaaagcgttcgaaatgtaccacgcagcaggcgtcgcggttcccgtattc
gcacttagaaccgaaaatggttttggtgttggtgaatttaatgaccttaaaaatctcgct
gactgggcaaaggaaaccaatctttcagtgctgcagattttaccgattaacgacaccact
gcaaattacacctggacagattcttatccttacgcagccatttcggtgtacgcgctgcac
ccgcaatatctttcacttgaaaaactggattttgcaattcctgaggatttgctggagcag
tttaatatggagaaaactgaacttaacagcctaagccttatcgattacgaaaagatgatt
tcggcgaaatggaaatacatcacggccgtttttaatctgaataaagacgaaattttaaaa
gacaggaatttccgcaaatttttaaaagaaaacgatgagtggctgttgccatatgctgca
ttctgcgttcagcgtgataagtataaaacgccggatttcaacagctggaagacgcataaa
aaatatattccgggtaagatcgcaccttttttcaccgcaaaaagcaaagatttctccaca
accatgcttcacgcctgggtgcagtaccagcttcatgttcagctaaaggaagctatcgat
tatacgcatgaactaggtatttcggttaaaggtgatttaccgatcggtatttaccggcat
tcggttgaagcctggaccgaacccgacctgttcggaatggattttcaggcaggtgctcca
ccggatcagtttaccgaattgggccaaaactgggaattcccgacctataattgggaggcg
atgaaagcagacggttaccgctggtggaaaaaccgtttcaaagcccttgagcagtatttt
gatgcgatgagaattgatcatattttgggcttcttcaggatctggcggatgccggtaagc
gccacacagggtcttcttgggtatttctatcccgcagttcccgtaacagcagatgaattc
agatccagaaatattccgtttaatgaagaccgttactgcaaaccttttatcaacgatcag
attctgtgggatgaattcggtatggaaagagacgcgattcataaccattttatgaataat
cactttaatggaatttatacctttaaagaagaattcgacactcaaagaaaattaactgat
tactttaaacaaaacccatacggttgggcggaggaaaaactgatttcactttgcgcgaac
gtacttttcctcatagaagaaaaagacggtgaaggggtatatcatccacggttcaatgtc
tctagaaccacttcgtatcaatatctgccggattgggaaagagctgctatcaacgatctt
tacaatgattatttcttcaaacgccaggacggtttgtggtaccagaaagcaatggagaaa
cttcctgtgatccttaacgcaactgatatgttgatttgtggtgaagatttaggttttgtg
cccgaatctgtacccgttgtaatggacaggcttgcaattacagcgttgaaagttcagcgg
atgccatctgatgatgtggcctggtataacccaaaagaagccggctatatgaacgtggtg
actgcgagttcgcacgacagttctacgctgcggcagtggtggcatgaagaccggaacctc
acgcaacagtatttccgtgatcagcttgggcaggctgggaccgcgccacacaacctggag
ccgcagctcgcagagatgataatgaaacagcatctgtacaacgacgcgatgctggcaatt
ttcccgatacaggaatttctagccaccgatcctgcgcttacaagggctgaaatggacgaa
gaaaggattaaccaacccgcggttttcccgcattactggagatacaggatgcaccttaac
cttgaaaaccttctggataagggagatttcaacaataaaatcgccggttgggtagcagat
tcaaacagaatgtaa

DBGET integrated database retrieval system