KEGG   Flavobacteriaceae bacterium: FIC_00587Help
Entry
FIC_00587         CDS       T00953                                 

Definition
1,4-alpha-glucan branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FIC_00587
Enzymes [BR:fba01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FIC_00587
Exosome [BR:fba04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FIC_00587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
605250..607265
Genome map
AA seq 671 aa AA seqDB search
MENVISHSLFTDHDIYLFREGSHYKLYDKFGAHTIEVSGIAGVYFAVWAPNANEVSVIGT
FNGWHSESHKLFPRWDGSGIWEGFIPDLKWGDLYKYAIRTNKDVLLEKGDPFALSWEQNV
QAGSVISTTWFEWTDQNWMAERWKNNSFEAPISVYEMHLGSWMRGTDDPDKFFSYREIAA
RLVPYLKEMNFTHVEFMPVMEYPYDPSWGYQVTGFFAGTSRFGSPQDLMFLISELHQNGI
GVILDWVPSHFPGDANGLHFFDGTFLYEHEDPRKGFHPDWKSYIFNYGRPEVKSFLISNA
MFWLDRYHADGLRVDAVTSMLHLDYSRNEGEWEPNVEGGNVNLEAKKFLQDFNKAVYKEF
PDIITIAEESSDFPMLTKPVHDGGIGFGMKWMMGWMHDTLKYFKTDPLGRKFEHNKLTFA
SMYMYNENYMMPLSHDEVVHGKASLIYKMPGDEWQKFANLRALYTYMYTHPGAKLLFMGC
EFAQTREWNFTQSLDWHLLGYEVHKGMQSYVKDLNKIYSAEKSLHENQFKPEGFEWVEAN
DDNNSIYIYLRKGKTEDDVTMTVLNLTPRVFDYKIGINEGTRWDVILNSDERKYGGSGVD
AEIVDEEDDEWMYRPNAVILRLPPLAGVVLRQQKSAEVEPLNKVSNKTSKKTAGNGKKAG
AGKKTKTSAKK
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatgttatttctcactccttgtttacggaccacgatatttatctttttcgcgaa
ggaagccattataaactctacgataaattcggtgcgcacaccattgaagtttccggtatt
gcaggcgtttattttgcagtatgggcgcccaacgctaacgaagtttcggtaatcggtact
tttaacggttggcattcagaatctcataaactttttcccagatgggacgggtcagggatt
tgggaagggtttattccggatcttaaatggggcgatctttacaaatacgcgatccgcaca
aataaagacgttcttctcgaaaaaggagatccttttgccctgagttgggagcagaacgtg
caggcgggttctgtaatttcaacaacctggtttgaatggacagaccaaaactggatggca
gaacgctggaaaaacaacagtttcgaagcaccgatatcagtatacgaaatgcatctgggt
tcctggatgcgaggcacagacgatcccgataagtttttcagctaccgagagatcgcggcg
cgactggttccgtatctgaaggaaatgaatttcactcacgtggaatttatgcccgtaatg
gaatatccgtatgatccgagttggggttatcaggtgaccggtttttttgccggaacgtcg
cgttttggctcaccacaggacctgatgtttctgatcagcgaactccatcagaatggaatt
ggtgtcattctcgattgggtgccctcgcatttcccgggagacgcaaatgggctgcatttt
ttcgacggaacttttctctacgaacatgaagatccacgtaaaggcttccatccagactgg
aaatcatatatcttcaattatggccggcctgaggtgaaatcttttctgatttcgaatgca
atgttctggcttgaccgttatcatgccgacggccttcgggtagatgccgtaacttcaatg
cttcacctggactattcgcgaaacgagggtgagtgggaaccgaacgttgaaggcggcaac
gttaacttagaagccaaaaaatttctacaggattttaataaagcggtgtataaagaattt
ccggatatcattaccattgctgaagaaagttcagatttcccgatgctcaccaagcctgtg
cacgacggcggcattggtttcggaatgaaatggatgatgggctggatgcatgatacgctg
aaatactttaaaacagatcctctcggccgcaaatttgagcataacaaactcacatttgcg
tcgatgtacatgtataatgagaattacatgatgccgctttcccacgacgaagtggttcat
ggcaaagcaagtctgatctacaaaatgcccggcgacgaatggcagaagtttgcaaacctg
cgcgcgctctacacctatatgtacacgcatccgggcgcaaaactgctgtttatgggctgc
gaattcgcacagacgcgcgaatggaatttcacgcagtctctggattggcatttgctcggt
tatgaggtgcacaaaggcatgcagagctatgtgaaagatttaaataaaatatactccgca
gaaaagtcgctgcacgaaaaccagttcaaacccgaaggattcgaatgggttgaagcgaat
gacgacaataattcaatctatatttatctaagaaaaggaaaaactgaggatgatgttacg
atgacggttcttaatcttaccccgcgcgtattcgattataagattggtataaacgaaggc
acacgctgggatgtaattcttaattccgatgaaagaaaatacggcggaagtggcgtggat
gctgaaatagtggatgaagaggacgatgagtggatgtaccgcccgaatgctgtaatatta
aggttgcccccactcgcaggtgttgttctgcgacagcaaaaatctgcggaggtcgagcct
ttaaacaaggtttcaaacaaaacatcaaagaaaaccgcgggaaatggtaagaaagccggc
gccggtaaaaaaacgaaaacttctgcgaaaaagtaa

DBGET integrated database retrieval system