KEGG   Flavobacteriaceae bacterium: FIC_00668Help
Entry
FIC_00668         CDS       T00953                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FIC_00668
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FIC_00668
   00630 Glyoxylate and dicarboxylate metabolism
    FIC_00668
Enzymes [BR:fba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FIC_00668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
696254..697831
Genome map
AA seq 525 aa AA seqDB search
METSTTFRITAANRYEDIFSPELVEFLSALHTKFNSGRKRLLISRAMRQADFDQHRLPSF
MSETEKIRKGEWICAPLPKDLQDRRVEITGPVERKMIINALNSGASTFMADFEDSNSPTW
KNCIEGQKNLSDAVSRTLDFENEAGKRYKLNPVTAVLLVRPRGLHLEEKNIIIDGETASA
SLVDFGIYFFLNAKKLLENGSGPYFYLPKLEHYLEARWWNEVFMFSQDYLGIPQASIKAT
VLVETITASFQLDEILYELKEHSAGLNCGRWDYIFSYIKKFRNLPEFIVPDRDQVTMRSP
FMSAYSKRVIQVCHKRNVHAMGGMAAQIPVKNNEEANEAAYSKVRADKEREVKNGHDGTW
VAHPGLVPVAREIFDKLMPEKNQIHKKFEEYQISEADLLEIPKGTVTETGVRKNINVGIL
YIESWLMGVGAAALYNLMEDAATAEISRTQVWQWLNNEARLDDGRTLLPGMVLKWQEEEL
EKIREYVGAERFENGKFKLAAEIFDELVLNENFAEFLTLKAYNYI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttcaaccacattccgaataactgcagctaacaggtacgaagacatcttctca
ccagaacttgttgagtttctttctgccctgcacacaaagtttaattcaggcagaaaaagg
ctgctgatcagccgggcgatgaggcaggctgattttgatcagcaccgtttgccgtctttt
atgtctgaaaccgaaaaaatcaggaaaggcgagtggatctgcgcaccgcttcccaaagat
ctgcaggaccgcagagttgaaattacgggcccggttgagagaaagatgatcatcaacgcg
ctcaattccggggcatcaaccttcatggccgatttcgaggacagcaattcacccacctgg
aaaaactgtatcgaaggccagaaaaatctttcagatgctgtgtcgcgtacgcttgatttt
gaaaatgaagccggaaagcgatataaactgaatccagttacagcggttctccttgtccgg
cccagaggattacatcttgaagaaaaaaacattataatcgacggagaaacggcttcggcg
tcactcgtcgattttggaatctactttttcctgaacgccaaaaagcttcttgaaaacggt
tccgggccttatttttacctgccaaaactcgaacactatcttgaagcacgctggtggaat
gaagtctttatgttttctcaggattacctcggcataccgcaggcaagcatcaaagcaaca
gttcttgttgaaaccattacggcttcttttcagcttgacgagattttatacgagcttaag
gaacacagcgcaggccttaactgcgggcggtgggattacattttctcctacatcaaaaaa
ttcagaaatcttccggaattcattgtgcccgacagggatcaggtgacaatgcgttcgccg
tttatgagtgcatactctaaacgcgtgattcaggtttgccacaaaagaaatgtgcacgcg
atgggagggatggcggcgcagattccggtaaaaaataatgaagaggccaatgaagctgct
tattcgaaggttcgtgcagataaggagcgggaagtgaaaaacggtcacgacggcacctgg
gtggcacaccccggtctggtaccggttgcgagggaaatattcgacaaactgatgcccgag
aaaaatcagatccataaaaaattcgaagaataccaaatctccgaagccgacctgctcgag
attccaaaaggaacagttaccgaaaccggcgttagaaaaaacattaatgtcggcatcctt
tatattgagtcctggctgatgggtgtaggtgcggccgcactttataatctgatggaagat
gcggcaactgctgagatatcgcgtacgcaggtgtggcaatggcttaataacgaagcgagg
ctggatgacggccgaaccctgctgcccggaatggtgttgaaatggcaggaagaagaactc
gaaaaaataagggaatatgtcggtgctgaacgttttgaaaacggaaaattcaagctcgct
gcagagatttttgacgaactggtgctgaatgaaaatttcgcggaattcctgaccctgaaa
gcctataattatatttaa

DBGET integrated database retrieval system