KEGG   Flavobacteriaceae bacterium: FIC_00668Help
Entry
FIC_00668         CDS       T00953                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:fba01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fba00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:fba00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
696254..697831
Genome map
AA seq 525 aa AA seqDB search
METSTTFRITAANRYEDIFSPELVEFLSALHTKFNSGRKRLLISRAMRQADFDQHRLPSF
MSETEKIRKGEWICAPLPKDLQDRRVEITGPVERKMIINALNSGASTFMADFEDSNSPTW
KNCIEGQKNLSDAVSRTLDFENEAGKRYKLNPVTAVLLVRPRGLHLEEKNIIIDGETASA
SLVDFGIYFFLNAKKLLENGSGPYFYLPKLEHYLEARWWNEVFMFSQDYLGIPQASIKAT
VLVETITASFQLDEILYELKEHSAGLNCGRWDYIFSYIKKFRNLPEFIVPDRDQVTMRSP
FMSAYSKRVIQVCHKRNVHAMGGMAAQIPVKNNEEANEAAYSKVRADKEREVKNGHDGTW
VAHPGLVPVAREIFDKLMPEKNQIHKKFEEYQISEADLLEIPKGTVTETGVRKNINVGIL
YIESWLMGVGAAALYNLMEDAATAEISRTQVWQWLNNEARLDDGRTLLPGMVLKWQEEEL
EKIREYVGAERFENGKFKLAAEIFDELVLNENFAEFLTLKAYNYI
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggaaacttcaaccacattccgaataactgcagctaacaggtacgaagacatcttctca
ccagaacttgttgagtttctttctgccctgcacacaaagtttaattcaggcagaaaaagg
ctgctgatcagccgggcgatgaggcaggctgattttgatcagcaccgtttgccgtctttt
atgtctgaaaccgaaaaaatcaggaaaggcgagtggatctgcgcaccgcttcccaaagat
ctgcaggaccgcagagttgaaattacgggcccggttgagagaaagatgatcatcaacgcg
ctcaattccggggcatcaaccttcatggccgatttcgaggacagcaattcacccacctgg
aaaaactgtatcgaaggccagaaaaatctttcagatgctgtgtcgcgtacgcttgatttt
gaaaatgaagccggaaagcgatataaactgaatccagttacagcggttctccttgtccgg
cccagaggattacatcttgaagaaaaaaacattataatcgacggagaaacggcttcggcg
tcactcgtcgattttggaatctactttttcctgaacgccaaaaagcttcttgaaaacggt
tccgggccttatttttacctgccaaaactcgaacactatcttgaagcacgctggtggaat
gaagtctttatgttttctcaggattacctcggcataccgcaggcaagcatcaaagcaaca
gttcttgttgaaaccattacggcttcttttcagcttgacgagattttatacgagcttaag
gaacacagcgcaggccttaactgcgggcggtgggattacattttctcctacatcaaaaaa
ttcagaaatcttccggaattcattgtgcccgacagggatcaggtgacaatgcgttcgccg
tttatgagtgcatactctaaacgcgtgattcaggtttgccacaaaagaaatgtgcacgcg
atgggagggatggcggcgcagattccggtaaaaaataatgaagaggccaatgaagctgct
tattcgaaggttcgtgcagataaggagcgggaagtgaaaaacggtcacgacggcacctgg
gtggcacaccccggtctggtaccggttgcgagggaaatattcgacaaactgatgcccgag
aaaaatcagatccataaaaaattcgaagaataccaaatctccgaagccgacctgctcgag
attccaaaaggaacagttaccgaaaccggcgttagaaaaaacattaatgtcggcatcctt
tatattgagtcctggctgatgggtgtaggtgcggccgcactttataatctgatggaagat
gcggcaactgctgagatatcgcgtacgcaggtgtggcaatggcttaataacgaagcgagg
ctggatgacggccgaaccctgctgcccggaatggtgttgaaatggcaggaagaagaactc
gaaaaaataagggaatatgtcggtgctgaacgttttgaaaacggaaaattcaagctcgct
gcagagatttttgacgaactggtgctgaatgaaaatttcgcggaattcctgaccctgaaa
gcctataattatatttaa

DBGET integrated database retrieval system