KEGG   Flavobacteriaceae bacterium: FIC_00669Help
Entry
FIC_00669         CDS       T00953                                 

Definition
Isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FIC_00669
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FIC_00669
Enzymes [BR:fba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     FIC_00669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
697856..699142
Genome map
AA seq 428 aa AA seqDB search
MKNQEQIRQIEKDWLENPRWTGVQRPYSAEEVLKLRGSYQLDYTIAKLMSEKLWEKLNSQ
DFVAGLGALTGNQAVQEVDAGLEAIYLSGWQVAADANLSGEMYPDQSLYPANSVPSVVKR
INNALLRADQIQSVNGIDDSDRKEYLVPIVADAEAGFGGNLNAYELMKQMIEAGAAGVHF
EDQLSSAKKCGHLGGKVLVPTQEAINKLIAARLAADVCGVPTLVVARTDADAADLLTSDI
DTRDHKFVTGKRTTEGFFEVKNGVEQGIDRGLAYAPYADLIWMETSNPDLDYARKFAEGI
HAKFPGKMLAYNCSPSFNWAAKLSVEEMATFREDLAAMGYKFQFITLAGFHALNTSMFEL
ALAYKKRGMAGYSELQEREFALQKEGFRAVKHQNFVGTSYFDALQTVITSGDSSVVAMKD
STEAAQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaagagcaaatccggcagattgaaaaggactggctggaaaatccgagatgg
actggcgtacaaaggccgtattcagcagaagaagtactgaaattgagaggttcttaccaa
ctcgattacaccatcgcaaaactgatgtccgaaaaactttgggaaaaactaaacagccag
gatttcgttgccggcttaggcgcccttaccggaaaccaggcggtacaggaagtggacgca
ggccttgaagcgatttatctttcgggctggcaggtggcggcagatgctaatctttccgga
gaaatgtatcccgatcaaagtctttatccggccaactcggtgccgagcgtggttaaaaga
atcaataatgcgttacttagagccgatcagattcagtccgttaacggcattgatgattca
gacagaaaagaatatcttgttcctatcgttgccgatgcagaagcaggctttggcggaaac
ctgaatgcctacgagctgatgaaacagatgatagaagccggagcagccggagttcatttc
gaagatcagttgtcttcggctaaaaaatgcggacatctgggcggcaaagttctggtcccg
actcaggaagccatcaacaagctcattgcagctcgtttggcagccgatgtatgtggggtt
ccgacgcttgtagtagcccgaaccgatgctgacgcggcagatttgttgacttcagatatc
gatacaagagaccataagtttgtaaccggaaaaagaactaccgaaggtttctttgaagtg
aaaaatggcgtggaacagggcattgacagaggcctggcatacgcaccttacgcagatttg
atctggatggaaacatcaaatcctgatcttgattatgcaagaaaattcgcagaaggcatt
cacgcgaaattcccgggaaaaatgttggcttacaactgttcaccttcgttcaattgggca
gcaaaactgtctgttgaggaaatggcaactttccgcgaagatttggcggcgatgggttat
aaattccagttcattacccttgcaggcttccatgcgctcaatacttcgatgttcgaattg
gctttggcgtacaaaaaacgcggcatggcaggctacagcgagcttcaggaaagggagttc
gcgctgcagaaagaaggtttccgcgccgtgaagcaccagaattttgtaggaacttcttat
tttgatgcactgcaaacggtaataacttccggcgattcgtctgttgtggcgatgaaagat
tctaccgaagccgcgcagttccattaa

DBGET integrated database retrieval system