KEGG   Flavobacteriaceae bacterium: FIC_00707Help
Entry
FIC_00707         CDS       T00953                                 

Definition
aspartate 1-decarboxylase (EC:4.1.1.11)
Orthology
K01579  
aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
fba  Flavobacteriaceae bacterium
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FIC_00707
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    FIC_00707
Enzymes [BR:fba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     FIC_00707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736497..736847
Genome map
AA seq 116 aa AA seqDB search
MLIEVFKSKIHRVHVTESDLNYIGSITIDEDLLEASGIIVGERVFIVNVNNGERFDTYAI
KGKRKSGEVCLNGPAARRVQKGDIIIIIAYAQMTPEEAQHFQPKIIFPDEKTNLLT
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgttaattgaagtttttaaatcgaagattcaccgtgtacacgtcaccgaatctgatctt
aactatattggaagtattacgattgatgaggatctcctcgaagcctcgggaattatcgta
ggcgaacgtgttttcatcgtaaatgtgaacaatggcgaacgtttcgatacctacgcgatt
aaaggaaaaagaaaatccggcgaggtctgtctcaacggcccggccgcgcgaagggtgcag
aaaggcgacatcatcatcattattgcttatgcacagatgacgccagaggaagcgcagcat
ttccagcctaaaattatctttccggacgagaagaccaatcttctcacctga

DBGET integrated database retrieval system