KEGG   Flavobacteriaceae bacterium 3519-10: FIC_00781Help
Entry
FIC_00781         CDS       T00953                                 

Definition
(GenBank) Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00020  Citrate cycle (TCA cycle)
fba00310  Lysine degradation
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01120  Microbial metabolism in diverse environments
fba01130  Biosynthesis of antibiotics
fba01200  Carbon metabolism
Module
fba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FIC_00781
  Amino acid metabolism
   00310 Lysine degradation
    FIC_00781
Enzymes [BR:fba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FIC_00781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N GCV_H
Motif
Other DBs
NCBI-ProteinID: ACU07234
UniProt: C6X496
Position
813934..815190
Genome map
AA seq 418 aa AA seqDB search
MSILEMKVPSPGESITEVEIASWLVKDGDFVEKDQPIAEVDSDKATLELPAEESGIITLK
AEEGDVVQVGQVVCLIDRDGAKPEAAAPAEAPKTQNAEAPQAEQKVVEKPAIVQEKKEEK
PATYAAGAPSPAARKILDEKGVDAAQVSGSGKDGRITKQDAETAGVPAMGSATGSGGSRA
ISTTKLSMLRRKLAVRLVSVKNETAMLTTFNEVDMSEIFRIRKQYKDEFSQKHGVGLGFM
SFFTKAVTRALQMYPDVNASIDGDFKNNYEFCDISIAVSGPKGLMVPVLRNAENMSFRGV
EANIKSLADKVREGNISIDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIIQRP
VAVDGQVVIRPMMYVAMSYDHRVIDGRESVGFLVAVKEAIDNPKEFLMGGDERKALEL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattagaaatgaaagtcccgtctccgggagaatcgattacagaagttgaaatc
gcatcttggctggtgaaggacggcgattttgttgaaaaagatcagcccatcgcagaagta
gattccgataaggctacgctcgaactgcccgcagaagaaagcggcatcattacccttaaa
gcagaggaaggtgatgtggtacaggtagggcaggtcgtatgtctgattgatagggatggc
gcaaagcctgaagctgctgctcctgctgaagcaccaaaaacccagaatgcagaagctcca
caggctgaacagaaagtagtggaaaaacccgcaattgttcaggagaagaaagaagaaaaa
cccgcaacttacgctgcaggagcaccttctccggctgcgagaaaaatccttgatgagaaa
ggcgtagacgccgctcaggtttcaggctcgggtaaagacggacgaattaccaagcaggac
gcagaaactgcaggcgtgccggcaatgggctcggcaaccggcagcggaggttccagagca
atttctactaccaagctttcaatgctcagaagaaaactggctgtaagactggtttctgtt
aaaaacgaaacagcaatgcttaccacattcaatgaggtggatatgtctgaaatcttcaga
atcagaaagcagtataaagacgaattttcgcagaagcacggcgttggcctgggctttatg
tcgttctttacaaaagcggtaacacgtgcgttgcagatgtaccctgatgtgaacgcctca
attgacggcgatttcaaaaataattacgagttctgcgacatttcaattgccgtttcaggt
ccgaaaggattgatggttccggttcttagaaatgcagaaaacatgtctttccgcggtgtg
gaagctaatatcaaaagtttggctgataaagtgcgcgaaggaaacatcagcatcgacgag
atgaccggcggtacttttacgatcaccaacggaggtgtatttggatcaatgttatcaaca
ccaatcatcaacccgccacagtcggctattcttggtatgcacaatatcatccagcggcct
gttgcagtggatggtcaggtggttatccgtccgatgatgtatgttgcgatgtcttatgat
cacagagttatcgacggacgcgagtctgtaggtttcctggttgcggtgaaagaagcgatc
gacaatccgaaggaattcttgatgggaggtgacgagcgaaaagcgcttgaactttag

DBGET integrated database retrieval system