KEGG   Flavobacteriaceae bacterium: FIC_00781Help
Entry
FIC_00781         CDS       T00953                                 

Definition
dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FIC_00781
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FIC_00781
  Amino acid metabolism
   00310 Lysine degradation
    FIC_00781
Enzymes [BR:fba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FIC_00781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
813934..815190
Genome map
AA seq 418 aa AA seqDB search
MSILEMKVPSPGESITEVEIASWLVKDGDFVEKDQPIAEVDSDKATLELPAEESGIITLK
AEEGDVVQVGQVVCLIDRDGAKPEAAAPAEAPKTQNAEAPQAEQKVVEKPAIVQEKKEEK
PATYAAGAPSPAARKILDEKGVDAAQVSGSGKDGRITKQDAETAGVPAMGSATGSGGSRA
ISTTKLSMLRRKLAVRLVSVKNETAMLTTFNEVDMSEIFRIRKQYKDEFSQKHGVGLGFM
SFFTKAVTRALQMYPDVNASIDGDFKNNYEFCDISIAVSGPKGLMVPVLRNAENMSFRGV
EANIKSLADKVREGNISIDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIIQRP
VAVDGQVVIRPMMYVAMSYDHRVIDGRESVGFLVAVKEAIDNPKEFLMGGDERKALEL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatattagaaatgaaagtcccgtctccgggagaatcgattacagaagttgaaatc
gcatcttggctggtgaaggacggcgattttgttgaaaaagatcagcccatcgcagaagta
gattccgataaggctacgctcgaactgcccgcagaagaaagcggcatcattacccttaaa
gcagaggaaggtgatgtggtacaggtagggcaggtcgtatgtctgattgatagggatggc
gcaaagcctgaagctgctgctcctgctgaagcaccaaaaacccagaatgcagaagctcca
caggctgaacagaaagtagtggaaaaacccgcaattgttcaggagaagaaagaagaaaaa
cccgcaacttacgctgcaggagcaccttctccggctgcgagaaaaatccttgatgagaaa
ggcgtagacgccgctcaggtttcaggctcgggtaaagacggacgaattaccaagcaggac
gcagaaactgcaggcgtgccggcaatgggctcggcaaccggcagcggaggttccagagca
atttctactaccaagctttcaatgctcagaagaaaactggctgtaagactggtttctgtt
aaaaacgaaacagcaatgcttaccacattcaatgaggtggatatgtctgaaatcttcaga
atcagaaagcagtataaagacgaattttcgcagaagcacggcgttggcctgggctttatg
tcgttctttacaaaagcggtaacacgtgcgttgcagatgtaccctgatgtgaacgcctca
attgacggcgatttcaaaaataattacgagttctgcgacatttcaattgccgtttcaggt
ccgaaaggattgatggttccggttcttagaaatgcagaaaacatgtctttccgcggtgtg
gaagctaatatcaaaagtttggctgataaagtgcgcgaaggaaacatcagcatcgacgag
atgaccggcggtacttttacgatcaccaacggaggtgtatttggatcaatgttatcaaca
ccaatcatcaacccgccacagtcggctattcttggtatgcacaatatcatccagcggcct
gttgcagtggatggtcaggtggttatccgtccgatgatgtatgttgcgatgtcttatgat
cacagagttatcgacggacgcgagtctgtaggtttcctggttgcggtgaaagaagcgatc
gacaatccgaaggaattcttgatgggaggtgacgagcgaaaagcgcttgaactttag

DBGET integrated database retrieval system