KEGG   Flavobacteriaceae bacterium: FIC_00842Help
Entry
FIC_00842         CDS       T00953                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FIC_00842
  Amino acid metabolism
   00340 Histidine metabolism
    FIC_00842
Enzymes [BR:fba01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     FIC_00842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
875553..876848
Genome map
AA seq 431 aa AA seqDB search
MNTIYKYPPREIWKNLISRNVLKQENLKAAVQEIFDQVAENGDCALKQLTLKYDRAELET
FLVSESEINAAEALVSEKLKAAIATAKANIYTFHAAQKEDFGKIETMPGVSCWRVSRAIA
KVGLYIPGGSAPLFSTVLMLAVPAQIAGCREVILCTPPRADGSIDPAVLFTAKLCGISKI
YKVGGAQAIAAMNFGTESIPKVDKIFGPGNQYVTQAKMLATDYNIAVDLPAGPSEVLVIA
DRTAVPAFCAADLLAQAEHGTDSQVIFIAVDEEIFTQTLNEVSLQLEMLPRRDIAAEALE
NSRFILLDSVESALEFSNLYAPEHLILSVERAEDYLNDVASAGSVFLGNYTPESVGDYAS
GTNHTLPTNGFASSYSGVSLDSFVKKITVQQITVDGLQNIGQTVEIMAEAEGLSAHKNAV
SIRLKMIKDGI
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaatactatttataaatatccaccccgggaaatctggaaaaacctgatcagccggaat
gttttaaagcaggaaaacctcaaagctgcggttcaggaaatatttgatcaggttgctgaa
aacggcgattgtgcgcttaaacagttaacgctgaagtacgaccgcgcagaacttgagaca
tttttggtttcggaatctgaaattaacgctgccgaagcgttggttagtgaaaaacttaaa
gcagcaattgctaccgccaaagctaatatttatacatttcacgcggcgcaaaaggaagat
tttggtaagattgaaactatgcccggcgtttcgtgctggcgcgtaagcagggcgattgca
aaagtagggttgtacattccgggtggaagcgcacctttgttttctaccgtgctgatgctt
gcggttcccgcccagattgcaggctgcagggaagtgattttgtgcacgcctccacgggcg
gatggcagcattgatccggctgttctgttcaccgcaaaactttgtggaatttcaaaaata
tataaagtgggcggcgcccaggctatcgcagcgatgaacttcggcaccgaaagtattcca
aaagttgataaaatttttggtccgggaaatcaatacgtaacccaggcaaaaatgctggcg
acggactataacatcgcggtggacttacctgcaggaccaagcgaagtgctcgtgattgcc
gacagaaccgcagttcccgcgttttgtgctgcagatttgctcgcacaagctgaacacgga
acggattcgcaggttatttttattgcggtggacgaagaaattttcacgcagactttgaat
gaagttagtcttcagcttgaaatgcttcccagacgcgatattgcggcagaggcattggag
aatagccgttttattttattggattctgtggaaagcgcgctcgaattcagtaacctatac
gcgcccgagcacctgattttgtcggttgagcgcgctgaagattatttaaatgatgtcgca
agtgcgggatcggtatttttaggtaattacacgcccgaatcggttggcgattacgcgagc
ggcaccaatcacaccttgcctacaaacggtttcgcaagcagctacagcggtgtttcgctc
gacagttttgtgaagaaaattaccgttcagcaaattaccgttgacggtttacagaatata
ggtcagacagtagagatcatggctgaggcagaaggtctaagtgctcacaaaaatgcggtt
tcaattcgcttaaaaatgataaaggatggaatttaa

DBGET integrated database retrieval system