KEGG   Flavobacteriaceae bacterium: FIC_00929Help
Entry
FIC_00929         CDS       T00953                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fba  Flavobacteriaceae bacterium
Brite
Enzymes [BR:fba01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     FIC_00929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
963658..964308
Genome map
AA seq 216 aa AA seqDB search
MQDSFLHKGKRKFLVEYLRDKVGISDEKVLKAINEVPRHLFLESIFEDYAYEDRAFPILA
KQTISHPSTVAEQTELLELTEKEKVLEIGTGSGYQTAVLVAMNTWVYTVERQKELHDFAF
RKLGELHLRPKFQSFGDGFAGLPTFAPFDKILVTCGAEKLPTELLHQLKIGGKMVIPLGR
TDEQILTRFTKRSEKEFEKEEFGAYKFVPMLNSTSH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattcatttttacacaagggaaaacgtaaatttttggttgagtatcttcgggat
aaagtaggaatatcggacgaaaaagttctgaaagctatcaacgaagttccgcgtcatctt
tttcttgaaagtatttttgaagattacgcctatgaagaccgcgcctttccgattcttgcc
aagcagacgatatctcacccatcaactgttgccgagcaaaccgaacttcttgaactgact
gaaaaggaaaaagtgcttgagataggcaccggaagcggctatcaaacagcggttttggta
gcgatgaatacctgggtttatacggttgagcgccaaaaagagcttcacgattttgctttc
cgcaaactaggtgaactgcatcttcgtccaaaattccagagtttcggtgatggtttcgca
ggcttgccgactttcgcgcctttcgataaaattcttgtaacctgcggtgccgaaaaacta
ccgacagagctgcttcaccaactcaagataggtggaaaaatggtgattccattaggccga
accgatgagcaaatcctcactcgtttcacaaaacgttccgaaaaagaattcgaaaaagag
gagtttggcgcctataagtttgtgccgatgctgaacagtaccagccactaa

DBGET integrated database retrieval system