KEGG   Flavobacteriaceae bacterium: FIC_01401Help
Entry
FIC_01401         CDS       T00953                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:fba01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fba00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:fba00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fba00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1520054..1521739)
Genome map
AA seq 561 aa AA seqDB search
MAEVIAMPRLSDTMTDGKVAKWHKKVGDAVKEGDILAEIETDKAVQDFESEVNGTLLYIG
TEEGGSAPVDTVLAIIGEQDEDISALKGGASSQQAGGTSEKEGAGIPEENKTEQNVTDVE
TTKPVEKEQEGSTQSTDIPKGVEVITMPRLSDTMTEGKVAKWHKKVGDTVKEGDILAEIE
TDKAVQDFEAEVNGTLLYIGTEEGGANPVDTVLAIIGPEGTDVSSIISGGGKKAQKAPES
SNSTTSDSKEVSENKPAVAASSGDERIAISPLARKMAEDKGIDVHALKGSGENGRIVKKD
VEGFNAEAQPQKSASSSENAASAQPKAAPSPAFIQGEDSETPNSQVRNIIAKRLSESKFT
APHYYLIIEVDMDKSIQARKEINSLPDTKISFNDMVIKATAMALRKHPQVNSTWHADKIV
HHGNINVGVAVAIPDGLVVPVLKNTDQMNYNQISAAVKDMAGRAKSKGLKANEMEGSTFS
VSNLGMFGIETFTSIINQPNSAILSVGAIVEKPVVKNGQIVVGNTMKLSLACDHRVVDGA
TGAQFLQTLKTYLEQPLTLLL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattgcaatgccccggctttccgacacgatgacggacgggaaggtggcg
aaatggcacaaaaaagtgggcgatgccgtaaaagaaggcgatattttagcggaaattgaa
accgacaaagctgttcaggattttgaatcagaagttaacggaacactgctctatattggt
actgaagaagggggctcagcacctgtcgacactgttttagcaattatcggtgaacaggac
gaagatatttcagcactgaaaggcggcgcttcctcacagcaggctggtggcacttctgaa
aaagagggtgctggaattccggaggagaacaaaaccgaacagaacgtaactgatgttgaa
accactaaacctgttgaaaaagaacaggaaggttcaacccaaagtaccgatatcccgaaa
ggtgttgaagtaattacgatgccgcgactttccgataccatgacggaaggaaaggttgct
aaatggcacaaaaaagtgggcgataccgttaaagaaggcgatatcctggctgaaatcgaa
accgataaggccgtgcaggatttcgaggctgaagtgaacggaacccttctatatattggt
actgaagaaggtggagctaatccggtagataccgtattggcgattatcggtccggaagga
actgatgtttcttcaattatttcgggtggaggaaaaaaagcacaaaaagcacctgagtct
tcaaattctaccacttccgattctaaagaagtgtctgaaaacaaacctgcagttgcagct
tcaagcggtgacgaaagaatcgccatttcgcctttagccagaaaaatggcagaagacaaa
ggaatcgacgtacatgcactaaaaggaagcggtgaaaacggcagaatcgttaaaaaagat
gttgaaggatttaatgctgaagctcagcctcagaaatctgcgtcgtcgtctgaaaacgct
gcttccgcgcagccaaaagcagcgccaagccctgcatttattcagggtgaagattcagaa
acaccaaattctcaggttagaaatattattgcaaaacgactttctgagagtaaattcacc
gcgcctcactattatctgatcattgaggtggatatggataaatcaattcaggcacgtaag
gaaatcaactcgttgccggataccaaaatttctttcaatgatatggtgattaaagctacg
gcaatggctttaagaaaacacccgcaggttaattctacctggcacgctgataaaatcgtt
catcacggaaacatcaatgtgggcgtggcagtagctattccggacggtttggtagttcct
gttctgaagaatacagatcagatgaattacaaccaaatctccgcagctgtgaaagatatg
gccggccgtgcaaaatctaaaggtttgaaagccaatgaaatggaaggttcaaccttctct
gtttcgaatttaggaatgttcggtattgaaacatttacatcaatcatcaatcagccaaat
tccgcgatcctttccgtaggtgcgatcgttgaaaaaccggttgtgaaaaacggacagatc
gttgtaggaaatacgatgaaactctcgctggcatgcgaccatagagtagtggatggcgcc
accggagcgcagtttttgcagacattaaaaacatacctggagcagccgttaactttgctt
ctctaa

DBGET integrated database retrieval system