KEGG   Flavobacteriaceae bacterium: FIC_01401Help
Entry
FIC_01401         CDS       T00953                                 

Definition
dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FIC_01401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIC_01401
   00020 Citrate cycle (TCA cycle)
    FIC_01401
   00620 Pyruvate metabolism
    FIC_01401
Enzymes [BR:fba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FIC_01401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1520054..1521739)
Genome map
AA seq 561 aa AA seqDB search
MAEVIAMPRLSDTMTDGKVAKWHKKVGDAVKEGDILAEIETDKAVQDFESEVNGTLLYIG
TEEGGSAPVDTVLAIIGEQDEDISALKGGASSQQAGGTSEKEGAGIPEENKTEQNVTDVE
TTKPVEKEQEGSTQSTDIPKGVEVITMPRLSDTMTEGKVAKWHKKVGDTVKEGDILAEIE
TDKAVQDFEAEVNGTLLYIGTEEGGANPVDTVLAIIGPEGTDVSSIISGGGKKAQKAPES
SNSTTSDSKEVSENKPAVAASSGDERIAISPLARKMAEDKGIDVHALKGSGENGRIVKKD
VEGFNAEAQPQKSASSSENAASAQPKAAPSPAFIQGEDSETPNSQVRNIIAKRLSESKFT
APHYYLIIEVDMDKSIQARKEINSLPDTKISFNDMVIKATAMALRKHPQVNSTWHADKIV
HHGNINVGVAVAIPDGLVVPVLKNTDQMNYNQISAAVKDMAGRAKSKGLKANEMEGSTFS
VSNLGMFGIETFTSIINQPNSAILSVGAIVEKPVVKNGQIVVGNTMKLSLACDHRVVDGA
TGAQFLQTLKTYLEQPLTLLL
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattgcaatgccccggctttccgacacgatgacggacgggaaggtggcg
aaatggcacaaaaaagtgggcgatgccgtaaaagaaggcgatattttagcggaaattgaa
accgacaaagctgttcaggattttgaatcagaagttaacggaacactgctctatattggt
actgaagaagggggctcagcacctgtcgacactgttttagcaattatcggtgaacaggac
gaagatatttcagcactgaaaggcggcgcttcctcacagcaggctggtggcacttctgaa
aaagagggtgctggaattccggaggagaacaaaaccgaacagaacgtaactgatgttgaa
accactaaacctgttgaaaaagaacaggaaggttcaacccaaagtaccgatatcccgaaa
ggtgttgaagtaattacgatgccgcgactttccgataccatgacggaaggaaaggttgct
aaatggcacaaaaaagtgggcgataccgttaaagaaggcgatatcctggctgaaatcgaa
accgataaggccgtgcaggatttcgaggctgaagtgaacggaacccttctatatattggt
actgaagaaggtggagctaatccggtagataccgtattggcgattatcggtccggaagga
actgatgtttcttcaattatttcgggtggaggaaaaaaagcacaaaaagcacctgagtct
tcaaattctaccacttccgattctaaagaagtgtctgaaaacaaacctgcagttgcagct
tcaagcggtgacgaaagaatcgccatttcgcctttagccagaaaaatggcagaagacaaa
ggaatcgacgtacatgcactaaaaggaagcggtgaaaacggcagaatcgttaaaaaagat
gttgaaggatttaatgctgaagctcagcctcagaaatctgcgtcgtcgtctgaaaacgct
gcttccgcgcagccaaaagcagcgccaagccctgcatttattcagggtgaagattcagaa
acaccaaattctcaggttagaaatattattgcaaaacgactttctgagagtaaattcacc
gcgcctcactattatctgatcattgaggtggatatggataaatcaattcaggcacgtaag
gaaatcaactcgttgccggataccaaaatttctttcaatgatatggtgattaaagctacg
gcaatggctttaagaaaacacccgcaggttaattctacctggcacgctgataaaatcgtt
catcacggaaacatcaatgtgggcgtggcagtagctattccggacggtttggtagttcct
gttctgaagaatacagatcagatgaattacaaccaaatctccgcagctgtgaaagatatg
gccggccgtgcaaaatctaaaggtttgaaagccaatgaaatggaaggttcaaccttctct
gtttcgaatttaggaatgttcggtattgaaacatttacatcaatcatcaatcagccaaat
tccgcgatcctttccgtaggtgcgatcgttgaaaaaccggttgtgaaaaacggacagatc
gttgtaggaaatacgatgaaactctcgctggcatgcgaccatagagtagtggatggcgcc
accggagcgcagtttttgcagacattaaaaacatacctggagcagccgttaactttgctt
ctctaa

DBGET integrated database retrieval system