KEGG   Flavobacteriaceae bacterium: FIC_01416Help
Entry
FIC_01416         CDS       T00953                                 

Definition
Nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    FIC_01416
Enzymes [BR:fba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     FIC_01416
    3.5.1.-  
     FIC_01416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1532446..1533051
Genome map
AA seq 201 aa AA seqDB search
MKKALIIVDVQNDFCEGGALAVPNANQIIPYINLLMEDNIYDQIVLTQDWHPANHKSFAS
NNGKKVGETIILNEIPQFMWPDHCVQDTFGAEFHKDLNIDKVTHIIQKGKNTDVDSYSAF
QDNNHFVKTGLDDFLKYHEIQLLEVVGLALDYCVKFTCLDASQLGYITCLHFNGTRAVNV
KPDNGKDAIYEMLQNSVTVLG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcccttataatagttgacgtacagaacgatttttgcgaaggcggcgcatta
gccgtgccgaatgccaaccagatcataccgtacatcaatcttctgatggaagacaatatc
tacgaccagattgtacttacacaggactggcatcccgcgaatcacaaaagtttcgcttca
aataacggcaagaaagtaggcgaaaccattatcctgaacgaaattccacagtttatgtgg
cccgatcactgtgttcaggatactttcggagccgaattccacaaagacctcaacatagac
aaagtgacgcacatcattcaaaaagggaaaaataccgacgtggacagctacagtgcgttt
caggataacaaccattttgtgaaaacaggtcttgacgattttcttaaatatcacgaaata
cagctactagaagttgtaggtctggcgctggattactgcgttaaatttacgtgtcttgat
gcgtcgcaacttggctacatcacctgcctgcattttaacggcacccgcgccgtgaatgtg
aagcccgacaacggtaaagatgcaatctacgagatgctgcagaattcggttaccgtttta
gggtaa

DBGET integrated database retrieval system