KEGG   Flavobacteriaceae bacterium 3519-10: FIC_01428Help
Entry
FIC_01428         CDS       T00953                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00480  Glutathione metabolism
fba00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    FIC_01428
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FIC_01428
Enzymes [BR:fba01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     FIC_01428
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ACU07876
UniProt: C6X638
Position
complement(1547014..1547583)
Genome map
AA seq 189 aa AA seqDB search
MKKIFILMLGVAAFVQSCTQQKKEISQDKNTVMNSIYDFKVESLDGGEIDFADFKGKKIL
IVNTASECGFTAQYADLEEISKTYAGKVVVVGFPANNFGGQEPGTNEEIGAFCEKNFGVT
FPLAAKVSVKGDDTAPIFKYLTDKDLNGVKNTSILWNFTKFLVDENGKLIDSFISTTKPT
DEKITKYFK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatttatcttaatgctcggcgtagctgcttttgtacaaagctgcacgcag
cagaaaaaagaaatttctcaggataaaaacacagttatgaacagcatttacgattttaag
gttgaaagcctcgacggtggtgagattgatttcgccgattttaaaggtaagaagatactc
atcgtgaacaccgcctctgagtgcggatttaccgcgcaatacgctgatctggaggagatt
tctaaaacctatgccggtaaagtggttgtggtgggttttcccgctaataattttggcggc
caagagccaggaaccaatgaagaaataggtgctttctgcgaaaagaattttggcgtaaca
tttccgcttgcggcaaaagtttcggtgaagggcgatgacaccgctccaatatttaaatat
ctgaccgataaggatttaaatggcgttaaaaacacctcaatcctctggaattttaccaaa
tttcttgttgacgaaaacggaaaactcatcgacagtttcatcagtacaacaaaacctacc
gacgaaaaaattactaaatattttaagtaa

DBGET integrated database retrieval system