KEGG   Flavobacteriaceae bacterium: FIC_01474Help
Entry
FIC_01474         CDS       T00953                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FIC_01474
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIC_01474
   00052 Galactose metabolism
    FIC_01474
   00500 Starch and sucrose metabolism
    FIC_01474
   00520 Amino sugar and nucleotide sugar metabolism
    FIC_01474
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FIC_01474
   00524 Butirosin and neomycin biosynthesis
    FIC_01474
Enzymes [BR:fba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FIC_01474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1595493..1596542)
Genome map
AA seq 349 aa AA seqDB search
MDANNKFKLYLPAILEERNNNNSLVAADVRKDKTFFAHYTTRDRKIVSSVEKAYPTQDFS
SFSEIAMRFVQEHQLTAVSKIAVAVPGPVIAGKSAPLRLPWELDAEEIKHRTNIPNVYLI
NDLEASAYGLGNDDASSFHTIHQSDKVVPGNIAVLAPGAGLGEAGLFWDGKFMRPFATEG
GHCEFSPRTNDEVEFYQFLQKLYGIVTWESVLSNDGLFNIYRFLRDVKLQQQPAWLTQEI
EAGNFTEAVINGALENRDRICNMTIDTFMIFLAREANSLVLKLKATGGLFLSGEIPVMLH
KYLNNDKFYKNFIVSDKMEVLLRDIPIYLVKDQKTIIQGAALYAAFSGE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggacgctaacaataaatttaagctttacctgcccgctattctggaggaacgcaataac
aataattccctggttgccgccgatgtacgcaaggataagacgttctttgcacattatact
acgcgcgaccggaagatcgtttcatcagttgaaaaagcatacccaacacaggattttagt
tccttttcagaaatcgcgatgcgtttcgttcaggagcatcaacttaccgcagtttctaaa
atagctgtagctgtgccgggccccgtaattgctggaaaaagtgcaccgttaaggcttccg
tgggaactcgatgccgaagaaattaaacaccgcaccaacatcccgaacgtatatctgatc
aatgacttggaagcatctgcctacggcctcggaaacgacgacgcaagctcttttcatacc
attcatcagtcggataaagtggtgcccggcaatatagcggtacttgctccgggtgcaggt
ttaggggaggcgggtcttttctgggacggcaaatttatgcgcccgttcgctaccgaaggc
ggacactgcgaattttcgccacgtacaaatgatgaagtggagttttaccagttcctccag
aaactgtacggtattgtaacctgggaatctgtgctttcaaatgacggacttttcaatatt
taccgtttccttagggacgtgaaactacagcaacagccggcttggcttacgcaagagatt
gaagcaggcaactttactgaggctgtaatcaacggggctttagaaaacagagaccgcatc
tgcaatatgacgattgatacatttatgatatttctggcgcgtgaggcgaacagccttgtg
ctgaaactgaaagcaaccggcggacttttcctgagtggcgaaataccggtgatgcttcat
aaatatctgaacaacgacaaattctataaaaacttcatcgtaagcgataaaatggaagtg
ctgttgcgcgatatcccaatctacctcgtgaaagatcaaaaaacaattattcagggagcc
gcactgtatgctgcattttcgggcgaatag

DBGET integrated database retrieval system