KEGG   Flavobacteriaceae bacterium: FIC_01488Help
Entry
FIC_01488         CDS       T00953                                 

Definition
dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FIC_01488
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FIC_01488
  Amino acid metabolism
   00310 Lysine degradation
    FIC_01488
Enzymes [BR:fba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FIC_01488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1606612..1607937)
Genome map
AA seq 441 aa AA seqDB search
MAEYKLILPSMGEGVMEATIISWLFAEGDMVKEDDSVVEIATDKVDSDVPTPVSGKIVKI
LKQKDEVAKIGEVIAILEIAGEGGAVADQPQEPKHADEVQTDIPQLSEQEIQELDKTLER
ATPQAFTGDLYLSPLVKNIAQQENISENELKSIKGTGMDGRITKENILAFIENRTSQPAP
AVAAPQTVAAPVQAAAPVFAPVKVGEGDEVIQMDRVRKIIADAMVNSKRISPHVTSFIET
DVTNVVKWRTKHKDIFEKREGEKLTYMPIFVKAIVKAIQDFPMINVSVDGDKIIKKKNIN
IGMATALPDGNLIVPVIKNADQLSLSGLAKAINDLAHRARNKKLRPEDTQGATYTISNVG
GFGNLMGTPIIPQPQVAIMAVGAIVKKPAVLETKDGDVIAIRSLMFMSHSYDHRVVDGSL
GGMFLKHVHDYLQNWDLNTEI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatataaattaatacttccttcaatgggagagggcgtgatggaagctacgatt
atcagctggctgttcgctgaaggcgacatggtgaaggaagatgattccgtcgtagaaatc
gcaacagacaaagtagattctgatgttccaacacctgtttccgggaagattgtgaaaatc
ctgaaacagaaggatgaagtagctaaaatcggcgaggtaattgcgatcctcgaaattgct
ggcgaaggtggcgctgtagcagaccaaccgcaggagccgaaacacgctgatgaggtgcag
accgacatccctcaactgtccgagcaggaaattcaggaactcgataaaactttagaaaga
gccacaccacaggccttcacgggtgatctttacctttcaccactggtcaaaaatatcgcg
cagcaggaaaatatttcagaaaatgaattgaaatcaatcaaaggaaccggcatggatggc
cggatcaccaaggaaaatatcctggcctttatcgaaaaccgtacttctcaacccgctcct
gcggttgctgcaccacaaacggtggctgctccagtgcaggctgccgcacctgttttcgca
cctgtgaaagtaggagagggcgatgaagtaattcagatggaccgcgttcgtaagatcatt
gctgatgcaatggtaaattcaaaaagaatctctccgcacgtcacgtcattcattgaaacc
gacgtaaccaacgtggtgaaatggcgtacgaaacataaagatattttcgagaaaagagag
ggcgaaaaactcacctacatgccgattttcgtgaaagccattgtgaaagcaattcaagat
ttcccgatgattaacgtgtcggtggatggcgataaaatcattaaaaagaaaaacatcaat
atcgggatggccacagcgcttccggacggtaatttaattgttccggtgattaaaaacgct
gatcaactgtcactttcaggccttgcgaaagcaattaacgatcttgcgcaccgcgccaga
aataaaaaactcagacctgaagacacgcagggcgcaacgtataccatttccaacgttggc
ggattcggaaaccttatgggaacgcctattattcctcagccgcaggtcgcaattatggcc
gtgggcgcaattgtgaaaaaacctgcagtgctcgaaactaaagacggtgacgtgatagcc
atccggagcctgatgttcatgtcacattcttacgatcaccgcgtggtagacggctctctg
ggcggcatgttcctcaagcacgttcacgattatctgcagaactgggatctaaatacagag
atttaa

DBGET integrated database retrieval system