KEGG   Flavobacteriaceae bacterium: FIC_01488Help
Entry
FIC_01488         CDS       T00953                                 

Definition
dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FIC_01488
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FIC_01488
  Amino acid metabolism
   00310 Lysine degradation
    FIC_01488
Enzymes [BR:fba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FIC_01488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1606612..1607937)
Genome map
AA seq 441 aa AA seqDB search
MAEYKLILPSMGEGVMEATIISWLFAEGDMVKEDDSVVEIATDKVDSDVPTPVSGKIVKI
LKQKDEVAKIGEVIAILEIAGEGGAVADQPQEPKHADEVQTDIPQLSEQEIQELDKTLER
ATPQAFTGDLYLSPLVKNIAQQENISENELKSIKGTGMDGRITKENILAFIENRTSQPAP
AVAAPQTVAAPVQAAAPVFAPVKVGEGDEVIQMDRVRKIIADAMVNSKRISPHVTSFIET
DVTNVVKWRTKHKDIFEKREGEKLTYMPIFVKAIVKAIQDFPMINVSVDGDKIIKKKNIN
IGMATALPDGNLIVPVIKNADQLSLSGLAKAINDLAHRARNKKLRPEDTQGATYTISNVG
GFGNLMGTPIIPQPQVAIMAVGAIVKKPAVLETKDGDVIAIRSLMFMSHSYDHRVVDGSL
GGMFLKHVHDYLQNWDLNTEI
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatataaattaatacttccttcaatgggagagggcgtgatggaagctacgatt
atcagctggctgttcgctgaaggcgacatggtgaaggaagatgattccgtcgtagaaatc
gcaacagacaaagtagattctgatgttccaacacctgtttccgggaagattgtgaaaatc
ctgaaacagaaggatgaagtagctaaaatcggcgaggtaattgcgatcctcgaaattgct
ggcgaaggtggcgctgtagcagaccaaccgcaggagccgaaacacgctgatgaggtgcag
accgacatccctcaactgtccgagcaggaaattcaggaactcgataaaactttagaaaga
gccacaccacaggccttcacgggtgatctttacctttcaccactggtcaaaaatatcgcg
cagcaggaaaatatttcagaaaatgaattgaaatcaatcaaaggaaccggcatggatggc
cggatcaccaaggaaaatatcctggcctttatcgaaaaccgtacttctcaacccgctcct
gcggttgctgcaccacaaacggtggctgctccagtgcaggctgccgcacctgttttcgca
cctgtgaaagtaggagagggcgatgaagtaattcagatggaccgcgttcgtaagatcatt
gctgatgcaatggtaaattcaaaaagaatctctccgcacgtcacgtcattcattgaaacc
gacgtaaccaacgtggtgaaatggcgtacgaaacataaagatattttcgagaaaagagag
ggcgaaaaactcacctacatgccgattttcgtgaaagccattgtgaaagcaattcaagat
ttcccgatgattaacgtgtcggtggatggcgataaaatcattaaaaagaaaaacatcaat
atcgggatggccacagcgcttccggacggtaatttaattgttccggtgattaaaaacgct
gatcaactgtcactttcaggccttgcgaaagcaattaacgatcttgcgcaccgcgccaga
aataaaaaactcagacctgaagacacgcagggcgcaacgtataccatttccaacgttggc
ggattcggaaaccttatgggaacgcctattattcctcagccgcaggtcgcaattatggcc
gtgggcgcaattgtgaaaaaacctgcagtgctcgaaactaaagacggtgacgtgatagcc
atccggagcctgatgttcatgtcacattcttacgatcaccgcgtggtagacggctctctg
ggcggcatgttcctcaagcacgttcacgattatctgcagaactgggatctaaatacagag
atttaa

DBGET integrated database retrieval system