KEGG   Flavobacteriaceae bacterium: FIC_01491Help
Entry
FIC_01491         CDS       T00953                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FIC_01491
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FIC_01491
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FIC_01491
Enzymes [BR:fba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FIC_01491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1609186..1609968)
Genome map
AA seq 260 aa AA seqDB search
MINTDKMQFAASNIPKEKKLSIYFTAGVPELESTGEVLKLIQDAGAELVEIGMPYSDPVA
DGPVIQHAHERALKNGMTVAKLFEQLKKVKDEIKIPVILMGYINPVLTFGFENFCSECAD
SGVSGLIIPDVPPIEFEKNCRAVLKKYNLTFTFLVTPETSDERILYLDSLSSGFLYAVSS
SSTTGNATKDVNNEGYLTRLAELNLKNPVMIGFGIKNKADFSKVTAKAAGGIIGTAFVNI
LLSDEDWRTASRNFIQKVIN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattaacacagataaaatgcaatttgcagcgtccaacattccgaaagaaaaaaagctg
agtatttattttacggctggtgtccccgagcttgagagcaccggcgaagttttaaaactg
attcaggatgccggtgcagaattggtggaaatcgggatgccgtattccgaccctgtggca
gacggccccgtgattcaacacgcacatgagcgcgctctgaaaaacggaatgacggtcgct
aagctatttgaacaactgaaaaaggtaaaagatgaaattaaaatcccggtaattttaatg
ggttacattaatccggtcctgactttcggctttgagaacttctgtagcgaatgtgctgat
tcgggtgtatcgggattgattattcccgatgtacctcctatcgaatttgaaaaaaactgt
cgcgctgtgctcaaaaaatacaatcttacttttacatttctcgtgacacccgaaacttca
gatgaacgcatactttatctagattcattaagttccggctttctttacgcggtttcaagt
tcttcaacaacgggcaatgcaacgaaagatgttaataatgaagggtacttaacgcggctt
gctgagttgaatttaaaaaatccggtgatgattggtttcgggattaagaataaggcagat
ttcagcaaagtgacggcaaaagccgcaggcggaatcatcgggacggcatttgtaaatatc
ctgctttccgatgaagactggcgtacagcatcgcggaattttattcagaaggtcattaat
taa

DBGET integrated database retrieval system