KEGG   Flavobacteriaceae bacterium 3519-10: FIC_01491Help
Entry
FIC_01491         CDS       T00953                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00260  Glycine, serine and threonine metabolism
fba00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01130  Biosynthesis of antibiotics
fba01230  Biosynthesis of amino acids
Module
fba_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FIC_01491
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FIC_01491
Enzymes [BR:fba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FIC_01491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACU07938
UniProt: C6X6A0
Position
complement(1609186..1609968)
Genome map
AA seq 260 aa AA seqDB search
MINTDKMQFAASNIPKEKKLSIYFTAGVPELESTGEVLKLIQDAGAELVEIGMPYSDPVA
DGPVIQHAHERALKNGMTVAKLFEQLKKVKDEIKIPVILMGYINPVLTFGFENFCSECAD
SGVSGLIIPDVPPIEFEKNCRAVLKKYNLTFTFLVTPETSDERILYLDSLSSGFLYAVSS
SSTTGNATKDVNNEGYLTRLAELNLKNPVMIGFGIKNKADFSKVTAKAAGGIIGTAFVNI
LLSDEDWRTASRNFIQKVIN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattaacacagataaaatgcaatttgcagcgtccaacattccgaaagaaaaaaagctg
agtatttattttacggctggtgtccccgagcttgagagcaccggcgaagttttaaaactg
attcaggatgccggtgcagaattggtggaaatcgggatgccgtattccgaccctgtggca
gacggccccgtgattcaacacgcacatgagcgcgctctgaaaaacggaatgacggtcgct
aagctatttgaacaactgaaaaaggtaaaagatgaaattaaaatcccggtaattttaatg
ggttacattaatccggtcctgactttcggctttgagaacttctgtagcgaatgtgctgat
tcgggtgtatcgggattgattattcccgatgtacctcctatcgaatttgaaaaaaactgt
cgcgctgtgctcaaaaaatacaatcttacttttacatttctcgtgacacccgaaacttca
gatgaacgcatactttatctagattcattaagttccggctttctttacgcggtttcaagt
tcttcaacaacgggcaatgcaacgaaagatgttaataatgaagggtacttaacgcggctt
gctgagttgaatttaaaaaatccggtgatgattggtttcgggattaagaataaggcagat
ttcagcaaagtgacggcaaaagccgcaggcggaatcatcgggacggcatttgtaaatatc
ctgctttccgatgaagactggcgtacagcatcgcggaattttattcagaaggtcattaat
taa

DBGET integrated database retrieval system