KEGG   Flavobacteriaceae bacterium: FIC_01491Help
Entry
FIC_01491         CDS       T00953                                 

Definition
Tryptophan synthase alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fba01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fba00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fba00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1609186..1609968)
Genome map
AA seq 260 aa AA seqDB search
MINTDKMQFAASNIPKEKKLSIYFTAGVPELESTGEVLKLIQDAGAELVEIGMPYSDPVA
DGPVIQHAHERALKNGMTVAKLFEQLKKVKDEIKIPVILMGYINPVLTFGFENFCSECAD
SGVSGLIIPDVPPIEFEKNCRAVLKKYNLTFTFLVTPETSDERILYLDSLSSGFLYAVSS
SSTTGNATKDVNNEGYLTRLAELNLKNPVMIGFGIKNKADFSKVTAKAAGGIIGTAFVNI
LLSDEDWRTASRNFIQKVIN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgattaacacagataaaatgcaatttgcagcgtccaacattccgaaagaaaaaaagctg
agtatttattttacggctggtgtccccgagcttgagagcaccggcgaagttttaaaactg
attcaggatgccggtgcagaattggtggaaatcgggatgccgtattccgaccctgtggca
gacggccccgtgattcaacacgcacatgagcgcgctctgaaaaacggaatgacggtcgct
aagctatttgaacaactgaaaaaggtaaaagatgaaattaaaatcccggtaattttaatg
ggttacattaatccggtcctgactttcggctttgagaacttctgtagcgaatgtgctgat
tcgggtgtatcgggattgattattcccgatgtacctcctatcgaatttgaaaaaaactgt
cgcgctgtgctcaaaaaatacaatcttacttttacatttctcgtgacacccgaaacttca
gatgaacgcatactttatctagattcattaagttccggctttctttacgcggtttcaagt
tcttcaacaacgggcaatgcaacgaaagatgttaataatgaagggtacttaacgcggctt
gctgagttgaatttaaaaaatccggtgatgattggtttcgggattaagaataaggcagat
ttcagcaaagtgacggcaaaagccgcaggcggaatcatcgggacggcatttgtaaatatc
ctgctttccgatgaagactggcgtacagcatcgcggaattttattcagaaggtcattaat
taa

DBGET integrated database retrieval system