KEGG   Flavobacteriaceae bacterium: FIC_01492Help
Entry
FIC_01492         CDS       T00953                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FIC_01492
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FIC_01492
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FIC_01492
Enzymes [BR:fba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FIC_01492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1610091..1611272)
Genome map
AA seq 393 aa AA seqDB search
MENYKNPDVHGYYGEFGGAFIPEMLYPNVAELKEKYIEIIESAEFQEEFQDLLKNYVGRA
TPLYLAKNLSQKYYTQIYLKREDLNHTGAHKINNALGQALVAKKLGKRRIIAETGAGQHG
VATATACALLGLECIVYMGEVDIARQAPNVARMKMLGATIIPAVSGSKTLKDAVNEALRD
WINNPTTTHYIIGSVVGPHPFPDLVARFQSVISEEIKWQLNEKIGRQNPDYVMACVGGGS
NAAGAFYHFVDEPDVKIIAAEAGGFGVASGKSAATTFLGTLGVLHGSKSLVMQTADGQVI
EPHSISAGLDYPGIGPFHANLFKEKRAEFVSVTDEEALEAAMELTKLEGIIPALESAHAL
ALLKKKTFAEDDVVVICLSGRGDKDMETYLKHL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaaaattataaaaacccggatgtacacggatattacggcgaattcggcggcgctttc
attcctgaaatgttgtatcctaacgtggcagaacttaaggaaaaatatatagagattatt
gaatctgcagaatttcaggaagagtttcaggacctgctgaaaaactatgtagggcgagca
acaccgctctatttggccaaaaacttaagccaaaaatattacacgcagatctatctcaaa
cgtgaagatctgaatcacaccggtgcgcacaagatcaacaatgcgctcggacaggctttg
gtggctaaaaaactcgggaagcgacgtatcattgcagaaacaggcgcgggccagcacgga
gtggcaaccgctaccgcatgtgcgctgttgggtcttgaatgcattgtgtacatgggcgaa
gttgatattgcacgccaggctcccaacgtcgccagaatgaaaatgctcggcgcaacaata
attccggcagtttcgggctccaaaacgctgaaagacgccgtgaatgaagcgttacgcgac
tggattaataatccaacaactacgcattatatcattggaagcgtggtaggtccgcatcct
tttcccgatttggttgcgcgtttccagagtgtgatttcggaagagataaaatggcaacta
aacgaaaagattggccgccaaaatccagattatgtaatggcgtgcgtaggtggcggaagc
aatgccgcaggtgctttttaccattttgtggacgagccggacgtgaaaataattgcggca
gaagccggtggtttcggagtggcttcaggtaaatctgccgccactacttttctcggtaca
ttgggcgttttgcatggcagcaaaagtttggtgatgcaaaccgccgacgggcaggtaatt
gagccgcactcgatttctgcaggacttgattatcccggaattgggcctttccacgcgaat
ctgtttaaggaaaaacgcgctgaatttgtttccgtcacggacgaagaggcacttgaagcc
gcaatggagctcacaaaacttgagggaattattccggcgctcgaaagtgcacatgcattg
gcgctcttaaaaaagaaaacgttcgccgaagatgatgtggtggtgatctgcctgagtggt
cggggcgacaaagacatggagacttatctaaaacatttatag

DBGET integrated database retrieval system