KEGG   Flavobacteriaceae bacterium: FIC_01556Help
Entry
FIC_01556         CDS       T00953                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fba  Flavobacteriaceae bacterium
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fba03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1679846..1680523)
Genome map
AA seq 225 aa AA seqDB search
MYPKIIKAARLAPCRIKFYFCGMDYPSKVLAKAVEEISGLPGIGKKSALRLALHLLKQPE
TQAVALGDSLKKLVTEIKYCRECHNFSDHEVCDICANPKRTEEIICVVEDVRDVMAIENT
GKYRGKYLVLGGKISPMEGIGPNQLNISSIGKKLEKAGAKEIIFALSATMEGDTTAYYIY
RKFKDSGVNFSTIARGISVGDELEYADEISLGRSIQNRLPYHDKD
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtacccaaagataataaaagccgccagacttgcgccttgccgtattaaattttatttt
tgtggaatggactatccgagtaaggtactggcgaaagctgtggaagaaatctctggcctg
ccgggcatcggcaaaaaatcggcgttgcggcttgcgctgcatctgctgaagcagcccgaa
acgcaggctgttgcgctaggcgattcgctgaaaaaactcgtgaccgaaataaaatactgc
cgcgaatgccataatttttctgatcatgaggtctgtgatatttgcgcaaatccgaaaaga
accgaggaaattatctgcgtggtagaagatgtgcgcgacgtgatggcaattgaaaataca
ggtaaataccgcgggaaatatctggttttgggtggtaaaatatcgccgatggaaggcatt
gggcccaatcagctgaatatctcgtcaatagggaaaaagcttgagaaagccggtgcgaaa
gaaattatttttgctttaagtgcaacaatggagggcgataccaccgcatattatatttac
cgtaagttcaaggattccggtgttaatttttctacgattgcgcgtgggatttcggtaggt
gatgagctggaatatgccgacgagatttcgctcgggcgttccattcagaaccgtttgccg
tatcacgacaaagattga

DBGET integrated database retrieval system