KEGG   Flavobacteriaceae bacterium: FIC_01715Help
Entry
FIC_01715         CDS       T00953                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:fba00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FIC_01715
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    FIC_01715
Enzymes [BR:fba01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     FIC_01715
Two-component system [BR:fba02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   FIC_01715
Bacterial motility proteins [BR:fba02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    FIC_01715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1835297..1835857
Genome map
AA seq 186 aa AA seqDB search
MEHCEALIIGGSAGSLEVLLKVLPGLKETLSFPIIIVLHRKSGKDRILTDLLASKTVLNV
SEATEKDKIEPATVYIAPPDYHLLIENDRTFSLDASEKVNFSRPSIDVTFENAAAVYGEN
VVCLLLSGANTDGTAGLKDVQISGGRVLVQDPETATVRYMPENALLHVAADAVLDPEHIA
DFINKL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaacattgcgaagcactcattattggtggatctgccggcagccttgaagttcttttg
aaggtgttacccggtctgaaagaaacactttctttcccgatcatcatcgttctgcaccgc
aaatccggaaaagacagaatacttacggatctgcttgcgagtaaaacagtcctgaacgta
agcgaagccactgaaaaagataaaattgaaccagccacggtgtacattgccccacccgat
taccacctactgattgaaaacgaccgcactttttcccttgacgcctcagaaaaggtaaat
ttctcgagaccttcaattgatgtcacgttcgaaaacgccgcagccgtgtacggagaaaat
gtggtatgtttgctgctttcaggcgcgaacaccgacggcacggcaggcctcaaagacgtg
caaataagcggcggcagagtgcttgtacaggaccctgaaaccgctaccgtgcgttatatg
cctgaaaacgcactgcttcatgtggctgccgatgcggtgctggacccggaacacatcgcg
gattttataaacaaactttag

DBGET integrated database retrieval system