KEGG   Flavobacteriaceae bacterium: FIC_01715Help
Entry
FIC_01715         CDS       T00953                                 

Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:fba02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:fba02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1835297..1835857
Genome map
AA seq 186 aa AA seqDB search
MEHCEALIIGGSAGSLEVLLKVLPGLKETLSFPIIIVLHRKSGKDRILTDLLASKTVLNV
SEATEKDKIEPATVYIAPPDYHLLIENDRTFSLDASEKVNFSRPSIDVTFENAAAVYGEN
VVCLLLSGANTDGTAGLKDVQISGGRVLVQDPETATVRYMPENALLHVAADAVLDPEHIA
DFINKL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggaacattgcgaagcactcattattggtggatctgccggcagccttgaagttcttttg
aaggtgttacccggtctgaaagaaacactttctttcccgatcatcatcgttctgcaccgc
aaatccggaaaagacagaatacttacggatctgcttgcgagtaaaacagtcctgaacgta
agcgaagccactgaaaaagataaaattgaaccagccacggtgtacattgccccacccgat
taccacctactgattgaaaacgaccgcactttttcccttgacgcctcagaaaaggtaaat
ttctcgagaccttcaattgatgtcacgttcgaaaacgccgcagccgtgtacggagaaaat
gtggtatgtttgctgctttcaggcgcgaacaccgacggcacggcaggcctcaaagacgtg
caaataagcggcggcagagtgcttgtacaggaccctgaaaccgctaccgtgcgttatatg
cctgaaaacgcactgcttcatgtggctgccgatgcggtgctggacccggaacacatcgcg
gattttataaacaaactttag

DBGET integrated database retrieval system