KEGG   Flavobacteriaceae bacterium: FIC_01721Help
Entry
FIC_01721         CDS       T00953                                 

Definition
Magnesium chelatase, ChlI subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FIC_01721
Enzymes [BR:fba01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     FIC_01721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1839279..1840772
Genome map
AA seq 497 aa AA seqDB search
MPIIKHPSPNNKYMKNDTTIKELKNSGYTHKTINKEIQTKLITKIKAKEPVFEGLWGYED
TVVPQLKKAILAGHHINLLGLRGQAKTRIARSMVSLLDEYMPIVKGSEINDSPFQPISKF
ARDLVAEHGDDTPISWVHRSDRFFEKLATPDVNVADLIGDIDPIKAATLKLPYSDERVLH
YGMIPRANRCIFVLNELPDLQARIQVSLFNILQEGDVQIRGFQLRMPLDIQFLFTANPED
YTNRGSIVTPLKDRIGSQIFTHYPKTVALARQITEQEALVSEDDKAHITVPGLAKDLLEE
VAFAARESEYVDAKSGVSARLTISAMENLMAAAKLRLIESGVEQTTVRLVDFMSIIPSIT
GKIELVYEGEQEGADHVAKLLIDQAVMVQFEQLFPRIPKLEKEGIKTPYTDLIKWFDQNA
VELNYDDSDEEFYSKLESITPLSSIVEENVEHMSAEDKKFCKELILWALTIGKKLDRTEN
QNAYTFDSAGIGKYFSK
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcatcaaacatccatcacccaacaataaatatatgaaaaacgatacgacaatt
aaagaattaaagaattcaggatatacgcacaaaaccattaataaagaaattcagaccaag
ctcattaccaagataaaagccaaagaacctgtatttgaagggctttggggttacgaggat
actgtagttccccaacttaaaaaagcaattttggccggacatcacatcaaccttttaggt
ttgcgcggacaggcaaaaacccgcatcgccagaagcatggtcagcctgctcgatgaatat
atgccgatagtaaaaggctctgaaatcaacgacagtccgttccagccgatatcgaaattt
gcgcgtgaccttgttgccgaacacggcgatgatacgccaatctcgtgggtgcaccggtcc
gaccgtttcttcgagaaactcgcaacgcccgatgtgaatgtagctgacctgatcggcgat
atcgatccgattaaagctgcgactttgaaactgccgtattccgatgagcgcgtgctgcat
tacggaatgattccgcgtgccaaccgctgcatttttgttttgaatgaacttcccgatctg
caggcaagaattcaggtttcactattcaatattttgcaggaaggcgatgtgcagatccgc
ggatttcaactcagaatgcctttggatattcagttcctgttcacggcaaaccccgaagat
tatacgaaccgcggcagcattgtgacgcctctgaaagaccgtatcggttcgcagattttt
actcattacccgaaaaccgttgcgttagcccggcagatcacggagcaggaagcgcttgtt
tccgaggatgacaaagcgcacatcaccgttccgggtttggcgaaagaccttttggaagaa
gtcgcgttcgcggcgcgtgaaagcgaatatgttgatgccaaaagcggcgtgagcgcacga
cttaccatttcagcaatggaaaacctgatggcggctgcaaaactgaggctgattgaatct
ggagtggagcaaaccactgtaaggctggtcgatttcatgtcgatcatcccgtcgataacc
ggcaagatcgaacttgtttacgaaggcgagcaggaaggcgccgaccatgtggcgaagctg
ctgatcgaccaggcggttatggttcagttcgaacagcttttcccgcgcatcccgaaactc
gagaaagaaggcattaaaacgccgtacaccgacctcatcaaatggtttgaccaaaacgct
gtagaactcaattacgacgattccgatgaagaattttattccaaactcgagagcattacg
cctctttcgtcaattgtcgaagaaaatgtggaacatatgagtgctgaggataaaaaattc
tgcaaagaactgatattatgggcgttaaccatcggtaaaaaactggaccgtaccgaaaac
cagaacgcctacacatttgattctgcgggaattgggaagtattttagcaaataa

DBGET integrated database retrieval system