KEGG   Flavobacteriaceae bacterium: FIC_01733Help
Entry
FIC_01733         CDS       T00953                                 

Definition
endo-1,4-beta-xylanase A precursor (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
fba  Flavobacteriaceae bacterium
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1850880..1851998)
Genome map
AA seq 372 aa AA seqDB search
MNKSILIALFALVSCGVTQKSVSTEASLKDAFEDRFYIGTALNLNHIHGADTKGIDIVEK
HFSSIVAENCMKSMFLQPQEGQFFFDDADKFVAFGEKNNQFIIGHTLIWHSQAPDWFFTD
KDGNNVSAEVMKQRLKSHINTVVSRYKGRIQGWDVVNEAILEDGSYRKSKFYEILGEEFI
PLAFQYAREADPEAELYYNDYNEWYPKKIETVTKLINDLRSSGIRIDGIGLQGHVGLDTP
SIEEYEKTIVAYKNAGIKVSVTELEISALPSPWGTSANVADTVGYEAKMNPYTTGLPAEV
QSRWEQRYIDFFSLFKKYQETVQRVTFWGVADGDSWKNDFPIVGRTDYPLLFDRNYQAKP
VVKKLVELNKEK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaagtattttaatcgccttattcgcactggtttcgtgtggagttacgcagaaa
tccgtaagtactgaggcatccctgaaagacgcattcgaagatcggttctacatcggaacg
gctttgaatttaaatcatattcatggcgcggataccaaagggattgacattgttgaaaaa
catttttcgtccatagttgccgaaaactgtatgaaaagtatgttcctgcaacctcaggaa
gggcagttcttttttgatgacgcagataagtttgttgcgtttggtgaaaagaataatcag
tttataattggtcatactttaatttggcattctcaggcacccgactggttttttaccgat
aaagacggcaataatgtaagtgctgaagtgatgaagcaacgcctgaaaagccacatcaac
acggttgtttcacgatacaaaggtcgcattcagggttgggatgtagtgaacgaagcgatt
ttagaagacggttcttaccggaaaagcaagttttatgagatcttgggtgaagagtttatt
ccgctcgcgttccagtatgcgcgggaagccgatcctgaggccgaattatactacaacgac
tacaacgaatggtatccgaagaaaattgaaactgtaacgaaactcattaatgatctgcgt
tcgagtggtatccgcatcgatgggatcggtttgcagggccatgtcggtctggacacaccg
agtattgaagaatacgaaaaaaccatcgtggcgtacaaaaatgccggcattaaagtgagt
gtcactgaacttgagatttcggcattgccttcaccgtggggaacttcggcgaacgttgct
gatacggtaggatacgaagcgaagatgaacccttacacaaccgggcttccggctgaggta
cagagccggtgggagcagcgatatattgatttcttcagcctgtttaaaaagtatcaggaa
accgtgcagcgagtaactttctggggtgtggcagatggcgattcatggaagaatgatttc
ccgattgttggccgtacagattacccgttattgttcgacagaaattatcaggcaaaaccg
gtcgttaaaaaacttgttgaactcaacaaagagaaataa

DBGET integrated database retrieval system