KEGG   Flavobacteriaceae bacterium: FIC_01743Help
Entry
FIC_01743         CDS       T00953                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FIC_01743
   00051 Fructose and mannose metabolism
    FIC_01743
Enzymes [BR:fba01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     FIC_01743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1868394..1869779)
Genome map
AA seq 461 aa AA seqDB search
MTGKSYANIKENLLNKNYNMNILKGTKEFFPGVEQIKFEGVESRNPLAFRYYDADRVVMG
KPMKEWMRFATAWWHTLCADGSDPFGGPTIHHPWGTASDVIDRAKYKMDAGFEFMTKMGF
GYYCFHDVDLVDPSDNWKEYEANLQTIVEYAKEKQAASGIKLLWGTANVFSHERYMNGAS
TNPNFDVVACAATQVKNSIDATIALGGENYVFWGGREGYMSLLNTDMKREKDHLARFLTM
SRDYARSQGFKGTFLIEPKPMEPTKHQYDYDAETVIGFLRYYGLDKDFKLNLEVNHATLA
GHTFEHELQAAVDAGMLGSIDANRGDAQNGWDTDQFPIDTFDLTQAWLAILPNGGLGSGG
INFDAKIRRNSTDAEDLFIAHVAGMDAFARGLIAAAGILENSDYNKLRTERYASFDSGNG
KAFEQGTLTLEDLRKIAHESGEPQPKSGKQELFEAIVNMYI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgacagggaagagttatgcaaatattaaagaaaatttattaaataaaaactataatatg
aatattttaaaaggaacaaaagagttttttcctggagttgaacaaattaaattcgagggt
gtcgaaagcagaaacccgctcgccttccgatattatgatgcagaccgcgtggtaatgggc
aagccgatgaaagagtggatgcgttttgcaaccgcctggtggcacacgctgtgcgcggac
ggcagcgatccgtttggtggaccaacaattcatcatccgtggggaaccgcgtctgacgtg
atcgaccgtgcgaaatataaaatggatgcaggtttcgaatttatgaccaaaatgggattc
ggatattactgttttcatgatgtggatttggtagatccttccgataactggaaagaatac
gaagctaaccttcagacgattgtagaatatgccaaggaaaagcaggctgcttccggtatc
aaactgctttggggcaccgccaatgtcttttcgcacgagagatatatgaacggagcatcc
acgaatccaaatttcgatgtggtggcgtgcgcggctactcaggttaaaaattctatcgac
gcaaccatcgcgcttggtggtgaaaattacgttttctggggcggaagagagggttacatg
agccttttgaacactgatatgaagcgtgaaaaagatcacctcgcgagattccttacgatg
tcaagagattatgcacgttcgcagggttttaaaggaacttttctgatcgaacctaaacca
atggagcccaccaaacatcagtacgattacgatgcggaaacggtgatcggcttcctcaga
tattatggtttggataaagattttaaactcaaccttgaagtaaaccacgcaacactggca
ggccacaccttcgaacatgaacttcaggccgctgtagatgcgggaatgctcggaagcatc
gacgcgaaccgtggtgatgcacaaaacggctgggataccgatcagttcccgattgatacg
ttcgatcttacccaggcctggcttgcgattctgccaaatggcggtctgggaagcggcgga
attaatttcgatgccaaaatccgcagaaattctaccgatgccgaagacctctttatcgcg
cacgtggctggtatggacgcttttgcgcgcggacttatcgctgcagcaggcatccttgaa
aattcagattataacaaactgagaacggagcgttatgcctcattcgacagcggaaacgga
aaagccttcgaacagggcacccttacgctcgaggatttaagaaaaattgctcacgaatcc
ggcgagcctcagccgaaaagcggcaagcaggagctgtttgaagccatcgtaaatatgtat
atctaa

DBGET integrated database retrieval system