KEGG   Flavobacteriaceae bacterium: FIC_01750Help
Entry
FIC_01750         CDS       T00953                                 

Definition
fatty acid desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    FIC_01750
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FIC_01750
Enzymes [BR:fba01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FIC_01750
Lipid biosynthesis proteins [BR:fba01004]
 Desaturase
  First
   FIC_01750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1875415..1876167
Genome map
AA seq 250 aa AA seqDB search
MTIIIFIIVLWYSGLFFQTFFLHRYAAHQTYKMSRFGEKLCYFLTWVTQGSNYLSAYGYG
VMHRMHHAYADTEKDPHSPKYDHNLFTMMWRTKSIYQQINQQKVKIEEKFTKNVPQWESF
DKFASSWGSRIGWAVAYTLFFYFFATAWWQWILLPVAYMMAPIHGVIINWFGHIYGYVNF
KVSDTSKNLFRFDWLMMGEAYHNNHHKFGGRANFGGVRWHEIDVTYQIMILLDKMKLIKL
KPVPAVTREI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgacaattattatcttcatcattgttctgtggtattcaggactattcttccagactttt
tttctacaccgttatgctgcgcaccagacgtataaaatgtcgaggttcggcgaaaaactg
tgttattttttaacctgggtaactcagggttcgaactatctttctgcttacggctacggc
gttatgcacaggatgcaccatgcgtatgctgacacggaaaaagacccacattccccgaaa
tacgaccataatctgttcacgatgatgtggcgtacaaaatcaatctatcagcagattaac
cagcagaaagtaaaaatagaagagaaattcaccaagaacgttcctcagtgggaatctttc
gataagttcgcaagctcatggggctcacgaatcggctgggctgtggcttacacgctgttt
ttctacttctttgcaaccgcgtggtggcagtggattctgcttccggtagcgtacatgatg
gcgcctattcacggcgtaatcattaactggttcggacacatttacggttatgtgaacttt
aaggtttcggatacttctaaaaaccttttccgtttcgactggctgatgatgggcgaagct
taccataacaatcatcataaatttggcggcagagcgaatttcggtggcgtaagatggcac
gaaatagatgttacctaccagattatgattcttcttgataaaatgaaactgattaaactg
aaaccggttccggccgttaccagagagatctaa

DBGET integrated database retrieval system