KEGG   Flavobacteriaceae bacterium: FIC_01999Help
Entry
FIC_01999         CDS       T00953                                 

Definition
50S ribosomal protein L36
Orthology
K02919  
large subunit ribosomal protein L36
Organism
fba  Flavobacteriaceae bacterium
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:fba03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2167458..2167574)
Genome map
AA seq 38 aa AA seqDB search
MKVRASIKKRSADCKIVRRKGVLFVINKKNPKFKQRQG
NT seq 117 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttagagcatctatcaaaaaaagaagtgctgattgcaaaatcgttcgcagaaaa
ggcgtcctgtttgtaatcaacaagaaaaaccccaaatttaaacaaagacaaggctaa

DBGET integrated database retrieval system