KEGG   Flavobacteriaceae bacterium: FIC_02107Help
Entry
FIC_02107         CDS       T00953                                 

Definition
Nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    FIC_02107
Enzymes [BR:fba01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     FIC_02107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2275379..2277379
Genome map
AA seq 666 aa AA seqDB search
MKSLKLFGLATVVAISAVTGCKPKGTETAVSGDAAQKVYVAPGKYDEFYNFVSGGFNGQV
NVYGLPSGRLLKVLPVFSVNPENGYGYSEETKPMLQTSHGFIPWDDQHHLSLSQTKAEVD
GRWLFANANNTPRVARIDLKTFKTVEILEIPNSAGNHSSPFLTENTEFVVAGTRFAVPMD
DQNGDVPISSFKENFKGVLSFIGIDQQTGGMDLTFQIEAPGINFDLSHAGKGKSGDWFFF
SCYNSEKANTLLEVNASQNDKDFIMAVNWKKAAALAKAGKGRKVVTEYAHNKWDEETHSA
TSTMKKEVVVLSVQDMKDAMYMIPCPKSPHGVDIDPTGEYIVGSGKLAALIPVFSFDKIQ
KAIADKAFAGEYDGVQVIKYEAALYGEVQKPGLGPLHTEFDGKGNAYTSMFVSSEVVKWN
IKDLKVLDRTPTFYSVGHLMIPGGDTSKPFGKYMVAYNKITKDRYLPTGPELAQSAQLYD
ISGDKIQLLLDFPTFGEPHYAQALPGEMISKNQVKFFKIADNKHPYATKGEAESKVVREG
NKVHVYMTSIRSHFAPDNIEGVRVGDEVYFHVTNLEQDWDVPHGFAILGNENAELLIMPG
ETCTLKWVPKKAGMFPMYCTDFCSALHQEMQGYVRVSPAGSNTPLIYSLNNKKDNAQSPV
KPGETK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtcttaaattatttggactggcaaccgtagtggctataagtgccgtaactgga
tgcaaaccaaaaggcactgaaactgccgtaagcggcgacgccgcacaaaaagtgtatgtt
gcacccggtaaatatgatgagttctacaacttcgtcagcggcggcttcaacgggcaggtg
aatgtctatggattaccgagtggaaggttgcttaaagttcttccggtattttccgtaaat
cctgaaaacggatatggatacagcgaagagacgaaaccaatgctgcagacatcacacggc
ttcatcccatgggacgatcagcatcacctctcgctttcgcaaaccaaggctgaagttgac
ggccgctggctgtttgcaaacgccaacaatactccgcgcgttgcccgaattgatttaaag
acttttaaaacagttgaaattttagaaatacctaactcagctggtaaccactcctcgcct
ttccttacagaaaataccgaatttgtggttgcaggaacccgttttgcagtgccaatggat
gatcagaatggtgatgtgccaattagttcattcaaagaaaatttcaaaggtgtgctttct
tttatcggaattgatcagcagaccggcggaatggacttaaccttccagattgaagcaccc
gggatcaactttgacctttcgcatgccggtaaagggaaatcaggcgactggttctttttc
tcctgctataattcagaaaaagcaaatacgcttcttgaggtaaatgcgtcacaaaacgac
aaagacttcattatggcagtgaactggaaaaaagctgcagcactcgcaaaagccggaaaa
ggccgcaaagtggtgacagaatacgcccacaataaatgggatgaagaaacgcatagcgcc
acttctacgatgaagaaagaggttgtcgtactttccgtgcaagatatgaaggatgcgatg
tatatgatcccatgtccgaaatcgcctcacggtgtagacatcgatcctaccggagaatat
attgtaggttcaggtaaactggcagcactgatccctgtattcagttttgataaaattcag
aaagctatcgcagacaaagcgtttgccggagaatatgacggcgtacaggtgattaaatac
gaagccgcactgtacggtgaagtacagaagcctggtttaggcccgctgcacactgagttt
gacggaaaaggaaacgcctacacatcaatgtttgtatcgtctgaagtagtgaaatggaac
atcaaggacctcaaagtgctggacagaacgccaacgttctattccgtaggacacttaatg
attccgggtggcgacacttccaaacctttcggaaaatacatggtagcgtataacaaaatt
accaaagacagatatcttcctacaggaccagaattagcacaatctgcacagctgtacgat
atcagtggagataaaattcagctgctactggacttcccaactttcggtgaaccgcattac
gcacaggctttaccaggtgagatgatctctaaaaaccaggttaaattctttaaaattgcg
gacaataaacacccgtatgccacaaaaggagaagccgaaagcaaagtggttcgtgaaggc
aacaaagttcacgtttacatgacctcaattcgctcgcacttcgcaccggataatatcgaa
ggcgtccgggttggcgatgaagtgtacttccatgtcacaaaccttgagcaggattgggac
gtaccgcacggatttgcgatcttaggaaacgagaacgccgaactcctcatcatgccgggt
gaaacctgcacgctgaaatgggttccgaagaaagccggtatgttcccgatgtactgcacc
gatttctgcagtgcgctgcaccaggaaatgcaggggtacgtgagggtttcgccagcgggc
agtaacacgccgctgatctactcgctcaacaataagaaagacaatgcacagagccctgta
aaaccaggagaaactaaataa

DBGET integrated database retrieval system