KEGG   Flavobacteriaceae bacterium: FIC_02181Help
Entry
FIC_02181         CDS       T00953                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fba  Flavobacteriaceae bacterium
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fba00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:fba00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2346768..2347271
Genome map
AA seq 167 aa AA seqDB search
MITIVVAMGLKNEIGADNQLLWHLPQDLKHFKEITTGHPIIMGRKTYESIGRPLPNRTNI
VVSRKKDWFAEGVLIVGSLKEALKFAKKIDENVFVIGGGNIYEQTIDLADKLEVTLVKAE
INADIFFPKIDLKIWEKTSETCIDKDEKHAYDFCFQTFVKKVGSATS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaatcgtagtggcaatgggacttaagaatgagataggtgctgataatcagctt
ctttggcatttaccacaggatctcaaacattttaaagaaatcaccaccggccaccccatc
atcatgggtagaaaaacctacgaaagcatcggacggcctctgccaaaccgcacgaatatt
gtggtttcgcgaaaaaaagactggtttgcggaaggtgtcttaattgtaggaagcttgaaa
gaagccttgaaatttgctaaaaaaattgatgaaaacgtcttcgtcatcggtggcggaaac
atttacgaacagaccatagacctggctgacaaactggaagttacgcttgtaaaggctgaa
attaacgccgatatcttcttcccgaaaatcgaccttaaaatctgggagaaaacctcggaa
acctgcatagacaaagacgagaaacacgcctacgatttctgtttccagacttttgtgaaa
aaagtaggatctgcaacttcttaa

DBGET integrated database retrieval system