KEGG   Flavobacteriaceae bacterium: FIC_02262Help
Entry
FIC_02262         CDS       T00953                                 

Definition
Agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    FIC_02262
Enzymes [BR:fba01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     FIC_02262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2432828..2433682)
Genome map
AA seq 284 aa AA seqDB search
MKTYAGIPEENATLENSKVMLVTVPYDGTSTWGKGADKGPELFLDASENMELFDIETRTE
PYLEGVYLAGEISENSTPEAMTEAVYQKTKELLNHDGKLFTLFGGEHSVSIGSIRAVGEK
YENLTVLQLDAHTDLRPDFHGSTSNHACAVYEASKKHNLVQVGIRSMDAEEMEHVNQEQC
FWAHGIATNPNWIDDVLAKVSGNVYITIDLDAFDPSIAPSTGTPEPGGLQWYPTLELLKK
VFEKCNVVAFDIVELMDSPMPKPSAFLAAKLYYKMLAYYHLTSK
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatacgctggaattcccgaagaaaacgccaccttagaaaactcgaaagtaatg
ctggtaaccgtgccttacgacggaacttcaacttggggcaagggtgcagataaaggccct
gaacttttcctcgacgcttctgaaaatatggagcttttcgatattgaaacccgtacagaa
ccttatttggaaggcgtgtatctggcaggcgaaatttcagaaaattccactccggaggca
atgaccgaagcggtttatcagaaaacaaaagaacttcttaaccacgacggtaaattgttt
acgcttttcggcggtgaacactctgtttcgatcggttcgatccgtgcggtaggagagaaa
tatgaaaacctcaccgtattgcagctcgatgcacataccgatttaagacctgattttcat
ggttcaacctcaaatcacgcctgcgcggtgtatgaagccagcaaaaaacacaatcttgtt
caggtcgggatccgttctatggacgctgaagaaatggaacatgtaaatcaagaacagtgt
ttctgggcgcacggaatcgctacaaacccgaactggatcgacgatgtgctcgcaaaagtt
tcaggaaatgtttacatcacgattgatcttgatgcatttgatccgtcaatcgcgccgtca
accggaactcctgagccgggcggcctgcaatggtatccaactttggagctcttgaaaaaa
gtgttcgaaaaatgcaatgtcgtagcttttgatatcgtggaattaatggattcgccgatg
cctaaaccaagtgctttccttgcggcaaaactgtactataaaatgttggcttactatcat
ttgacttctaagtaa

DBGET integrated database retrieval system