KEGG   Flavobacteriaceae bacterium: FIC_02271Help
Entry
FIC_02271         CDS       T00953                                 

Definition
Ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FIC_02271
Enzymes [BR:fba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     FIC_02271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2439903..2440841)
Genome map
AA seq 312 aa AA seqDB search
MFYTALSSFIIISHAMNITPEQPKIIVVGSSSIDLVLNTNHLPKPNETVMAEKSESFFGG
KGANQAVGTARLGASVYFIGCVGMDPFGQQILRNLVDEGVNVGYVVETEQAATGAAYVST
SEGINSIVVVPASNFCLTPAHVSEAEKYFATADLVLVQLEIPMETVEYTAELARKNGTKI
GLYASPATKLSPDLIDASTFIVAKSNELSILFGEDKREEILKKYPNKLFVRDDSNSTTYY
NGSEMKYYRNDHDSVLHKMGMGDAFTAGFAVAMCHGNSVDECVKFGNDVSLKVTKNCGSQ
SGLPYLKDFSAE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgttttacaccgctttgtcttcgttcatcattatatcgcacgcaatgaatatcacccct
gagcaaccgaaaattatcgtcgtaggcagttcgtccatcgatctggtacttaatacgaac
catctgccaaaacccaacgaaacggtgatggccgaaaaatctgaaagtttcttcggtggc
aaaggcgccaaccaggctgtgggtaccgcgcgcctcggtgcaagcgtgtattttatcggt
tgtgtgggcatggatccgttcgggcagcagatactgcggaatttggtggatgaaggcgtg
aatgtcggatatgtggtggaaaccgaacaggctgcaaccggcgcggcttatgtaagcact
tccgaaggtatcaattccattgttgtggttcctgcttctaatttttgccttacgcctgcg
cacgtttcggaagctgaaaaatattttgctaccgctgaccttgttctggttcagcttgag
attccaatggaaaccgtagaatataccgcagaacttgcgaggaagaacggtactaaaata
ggcctgtatgcatcgcctgctacaaaattatcacctgatctgatcgatgccagcaccttt
attgtcgcaaaaagtaacgaactttcgattctgtttggcgaagataaacgtgaagaaatt
ttaaagaaatatccaaacaagctctttgtacgcgatgattcgaattccaccacgtactac
aacggttctgaaatgaaatattaccgcaatgaccacgactcggtgttgcacaaaatgggc
atgggcgatgctttcacggcaggattcgctgtcgccatgtgccacggaaattctgttgat
gaatgtgtgaaatttggcaacgacgtttcattaaaagtaaccaagaactgcgggtcgcaa
agcggactgccttatctgaaagatttcagcgccgaataa

DBGET integrated database retrieval system