KEGG   Flavobacteriaceae bacterium 3519-10: FIC_02425Help
Entry
FIC_02425         CDS       T00953                                 

Definition
(GenBank) uroporphyrinogen-III synthase HemD, putative
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00860  Porphyrin and chlorophyll metabolism
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FIC_02425
Enzymes [BR:fba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FIC_02425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ACU08858
UniProt: C6X345
Position
complement(2607324..2608070)
Genome map
AA seq 248 aa AA seqDB search
MMMKIKSILVSQPAPNESSPYLEMAKKEKIRIDFRPFIHVEGVDAKELRTQKIDLSQFTG
IIFTSKNAIDHYFRLAEEMRFAVPDSMRYICQSEAIANYLQKHIVYRKRKISFGERNFAD
LLPLFKKFPTEKYLIPAGETLSADTVKVLDSSSIDWTRATMYRTVSSDLSDIKLDEYDML
VFFSPQGIRSLGTNFKDFVQNDTKIAVFGTTTEMAAKEAGLVVNVMAPSKESPSMTMAIE
KYIRSINK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgatgatgaaaattaaatctatacttgtttcgcagcccgcacctaatgagtcttcccca
tatctggagatggccaaaaaggagaaaataagaattgatttcaggccgtttatacatgtt
gaaggagtagatgcaaaggagcttaggacccaaaagatcgatctttcccaattcacagga
attattttcaccagcaaaaacgctatcgaccattacttcaggcttgctgaggaaatgcgt
tttgcggtgcccgattctatgcgctacatctgccagtctgaggcaattgcaaactacctg
cagaaacacatcgtgtaccggaagcgtaaaatttctttcggtgaacggaattttgcggac
ctgctgccgcttttcaaaaaattcccgaccgaaaaatatcttattcccgccggtgaaacg
ctcagtgcagacaccgtgaaggttctggactcgtcctcaatcgactggacgcgtgctacg
atgtaccgtacggtgagcagtgatcttagcgatataaaactcgacgaatacgatatgttg
gtgtttttcagcccgcagggtatccgctcgctcggcaccaacttcaaagattttgtgcag
aacgataccaaaattgcggtattcggcactaccacagagatggcagccaaagaggccggc
ctggttgtaaatgtgatggcgccaagcaaagaaagcccttcgatgacgatggctattgaa
aaatatatcagaagcatcaataaatag

DBGET integrated database retrieval system