KEGG   Flavobacteriaceae bacterium: FIC_02513Help
Entry
FIC_02513         CDS       T00953                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FIC_02513
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIC_02513
   00052 Galactose metabolism
    FIC_02513
   00500 Starch and sucrose metabolism
    FIC_02513
   00520 Amino sugar and nucleotide sugar metabolism
    FIC_02513
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FIC_02513
   00524 Butirosin and neomycin biosynthesis
    FIC_02513
Enzymes [BR:fba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FIC_02513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2691846..2692814
Genome map
AA seq 322 aa AA seqDB search
MALVDLSKQVALGVDIGGTNTKFGIVNHRGEILEKGRMRTENFEKPEEFIDALYNEVAPH
LAKHCTHNQFDGIGVGAPNANYYTGTIEQAPNLRWKGIIPFAELMTKKFGVPCKMTNDAN
AAAYGEMMFGAARGMKDFIMMTLGTGVGSGIISGGKLIYGHDGFAGELGHTIVKPGGRKH
WSTGSEGSLEAYASATGIAITAKKMRAEFPESMLNDYPEEAINSKVVHECAKKGDPTAIE
VFRYTGQKLGEALANFVMFSSPEAILLFGGVIKAGDFILKPTKLHMERNLLPIFRNKVRL
VFSELDEADAAILGASALVWEK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcattagtagatttgtcgaagcaggtcgcattaggcgtcgatatcggcggtaccaac
acgaagttcggcatcgtaaaccaccgcggcgaaattctggagaaaggacgcatgcgcact
gaaaattttgagaaacccgaagaatttattgacgcactatataacgaagtggctcctcat
ctggccaaacactgcacacataatcaatttgacggaattggtgtaggcgcacctaatgca
aattactacaccggcaccattgagcaggctcccaacctgcgttggaaaggcattatccct
ttcgcagagcttatgactaaaaaattcggtgtgccctgcaaaatgaccaatgatgccaat
gctgctgcctacggcgaaatgatgttcggggcggcacgcggaatgaaagatttcatcatg
atgacgctcggtacaggcgttggcagcggaattatttccggcggtaaacttatttacggg
cacgacggcttcgcaggcgaacttggacacacgattgtaaaacctggcggcagaaaacac
tggagcacgggctccgagggctctttggaagcatacgcatccgcgacgggcattgccatt
acggccaagaaaatgcgtgctgaatttccggaatctatgctaaacgactatccggaagaa
gccatcaattctaaagtggtgcacgagtgtgctaaaaaaggcgatccaaccgcgattgaa
gtgttccgctataccggccagaaactgggcgaggctttggccaatttcgtgatgttttct
tcacctgaagccattttgctttttggtggcgttataaaagccggcgatttcatcttaaaa
cccaccaaactccacatggaacgcaaccttttgccgattttcagaaacaaggtcagactt
gtcttcagcgaactcgacgaagccgatgccgcaatcttaggcgcgagcgcgttagtttgg
gagaaataa

DBGET integrated database retrieval system