KEGG   Flavobacteriaceae bacterium 3519-10: FIC_02513Help
Entry
FIC_02513         CDS       T00953                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00010  Glycolysis / Gluconeogenesis
fba00052  Galactose metabolism
fba00500  Starch and sucrose metabolism
fba00520  Amino sugar and nucleotide sugar metabolism
fba00521  Streptomycin biosynthesis
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01120  Microbial metabolism in diverse environments
fba01130  Biosynthesis of antibiotics
fba01200  Carbon metabolism
Module
fba_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIC_02513
   00052 Galactose metabolism
    FIC_02513
   00500 Starch and sucrose metabolism
    FIC_02513
   00520 Amino sugar and nucleotide sugar metabolism
    FIC_02513
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FIC_02513
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FIC_02513
Enzymes [BR:fba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FIC_02513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FGGY_N Pan_kinase
Motif
Other DBs
NCBI-ProteinID: ACU08943
UniProt: C6X3D0
Position
2691846..2692814
Genome map
AA seq 322 aa AA seqDB search
MALVDLSKQVALGVDIGGTNTKFGIVNHRGEILEKGRMRTENFEKPEEFIDALYNEVAPH
LAKHCTHNQFDGIGVGAPNANYYTGTIEQAPNLRWKGIIPFAELMTKKFGVPCKMTNDAN
AAAYGEMMFGAARGMKDFIMMTLGTGVGSGIISGGKLIYGHDGFAGELGHTIVKPGGRKH
WSTGSEGSLEAYASATGIAITAKKMRAEFPESMLNDYPEEAINSKVVHECAKKGDPTAIE
VFRYTGQKLGEALANFVMFSSPEAILLFGGVIKAGDFILKPTKLHMERNLLPIFRNKVRL
VFSELDEADAAILGASALVWEK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcattagtagatttgtcgaagcaggtcgcattaggcgtcgatatcggcggtaccaac
acgaagttcggcatcgtaaaccaccgcggcgaaattctggagaaaggacgcatgcgcact
gaaaattttgagaaacccgaagaatttattgacgcactatataacgaagtggctcctcat
ctggccaaacactgcacacataatcaatttgacggaattggtgtaggcgcacctaatgca
aattactacaccggcaccattgagcaggctcccaacctgcgttggaaaggcattatccct
ttcgcagagcttatgactaaaaaattcggtgtgccctgcaaaatgaccaatgatgccaat
gctgctgcctacggcgaaatgatgttcggggcggcacgcggaatgaaagatttcatcatg
atgacgctcggtacaggcgttggcagcggaattatttccggcggtaaacttatttacggg
cacgacggcttcgcaggcgaacttggacacacgattgtaaaacctggcggcagaaaacac
tggagcacgggctccgagggctctttggaagcatacgcatccgcgacgggcattgccatt
acggccaagaaaatgcgtgctgaatttccggaatctatgctaaacgactatccggaagaa
gccatcaattctaaagtggtgcacgagtgtgctaaaaaaggcgatccaaccgcgattgaa
gtgttccgctataccggccagaaactgggcgaggctttggccaatttcgtgatgttttct
tcacctgaagccattttgctttttggtggcgttataaaagccggcgatttcatcttaaaa
cccaccaaactccacatggaacgcaaccttttgccgattttcagaaacaaggtcagactt
gtcttcagcgaactcgacgaagccgatgccgcaatcttaggcgcgagcgcgttagtttgg
gagaaataa

DBGET integrated database retrieval system