KEGG   Flavobacteriaceae bacterium: FIC_02513Help
Entry
FIC_02513         CDS       T00953                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fba  Flavobacteriaceae bacterium
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:fba01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fba00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fba00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fba00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:fba00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:fba00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2691846..2692814
Genome map
AA seq 322 aa AA seqDB search
MALVDLSKQVALGVDIGGTNTKFGIVNHRGEILEKGRMRTENFEKPEEFIDALYNEVAPH
LAKHCTHNQFDGIGVGAPNANYYTGTIEQAPNLRWKGIIPFAELMTKKFGVPCKMTNDAN
AAAYGEMMFGAARGMKDFIMMTLGTGVGSGIISGGKLIYGHDGFAGELGHTIVKPGGRKH
WSTGSEGSLEAYASATGIAITAKKMRAEFPESMLNDYPEEAINSKVVHECAKKGDPTAIE
VFRYTGQKLGEALANFVMFSSPEAILLFGGVIKAGDFILKPTKLHMERNLLPIFRNKVRL
VFSELDEADAAILGASALVWEK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atggcattagtagatttgtcgaagcaggtcgcattaggcgtcgatatcggcggtaccaac
acgaagttcggcatcgtaaaccaccgcggcgaaattctggagaaaggacgcatgcgcact
gaaaattttgagaaacccgaagaatttattgacgcactatataacgaagtggctcctcat
ctggccaaacactgcacacataatcaatttgacggaattggtgtaggcgcacctaatgca
aattactacaccggcaccattgagcaggctcccaacctgcgttggaaaggcattatccct
ttcgcagagcttatgactaaaaaattcggtgtgccctgcaaaatgaccaatgatgccaat
gctgctgcctacggcgaaatgatgttcggggcggcacgcggaatgaaagatttcatcatg
atgacgctcggtacaggcgttggcagcggaattatttccggcggtaaacttatttacggg
cacgacggcttcgcaggcgaacttggacacacgattgtaaaacctggcggcagaaaacac
tggagcacgggctccgagggctctttggaagcatacgcatccgcgacgggcattgccatt
acggccaagaaaatgcgtgctgaatttccggaatctatgctaaacgactatccggaagaa
gccatcaattctaaagtggtgcacgagtgtgctaaaaaaggcgatccaaccgcgattgaa
gtgttccgctataccggccagaaactgggcgaggctttggccaatttcgtgatgttttct
tcacctgaagccattttgctttttggtggcgttataaaagccggcgatttcatcttaaaa
cccaccaaactccacatggaacgcaaccttttgccgattttcagaaacaaggtcagactt
gtcttcagcgaactcgacgaagccgatgccgcaatcttaggcgcgagcgcgttagtttgg
gagaaataa

DBGET integrated database retrieval system