KEGG   Flavobacteriaceae bacterium: FIC_02537Help
Entry
FIC_02537         CDS       T00953                                 

Definition
Gll2474 protein
Organism
fba  Flavobacteriaceae bacterium
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2719474..2721171)
Genome map
AA seq 565 aa AA seqDB search
MKFKLLLILFSSHLIFAQQKHATPYETGNGNQTVTYEEMVKYYDDLDRNFESVTVQNFGK
DDNGEPIKVVVFNASKNRKNPVLLINNGIHPGEPDGIDATMTLMRDLATGKIKAKNLTVA
AVQSYNISGMLRRGKYSRANQNGPEEYGFRGNARNYDLNRDFIKNDSENAKAFQQIFHHF
KPIYFIDNHVSNGADYQYLFTYISTNKERLGKTLGTYFNEKMQPEILQTIEKQGILNTPY
VNIHGDSPDEGFPAFMDSPRYATGYTTLFNTLGTVAETHMLKPYSERVRATYEYMLSSIN
YVAKNASEIQKKMSESLAGYQPGKKYPIQWKSDKNKFKLIDFKGYEAGKKTSVVSGKPRL
FYDRTRPFTRKVKFFNEYIATKEIRIPNFYVIPKSENKVIEYLKRNHIEMKEIGQDSTVS
VELYRIADYKTVKNPYEGHYLHYDTKIKSEIKNKTFRKGDFLVSTKQSGVKYLLETLEPE
ATDSFFNWNFFDAILGQKEYFSDYVFEDTAAELLKNDQVLRTAFEFEKISNADFAKDGAA
QLEWIYKHSDYYEGSVGLYPIYRIL
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcaaattactactgattttattttcttctcatctgattttcgcgcaacaaaaa
catgcaactccttacgaaacaggcaacggaaaccaaaccgtaacctatgaggaaatggtg
aaatattatgatgatttagaccggaatttcgaaagcgtgaccgtgcagaatttcggtaaa
gacgataacggcgagccgataaaagtcgtggtttttaatgcctcaaaaaacaggaaaaac
cctgtactcctgatcaacaacggaattcatccgggcgaacccgacggcattgacgcgacg
atgactttgatgcgggatttagcgaccggaaaaattaaagcaaaaaacctcaccgtggcc
gcggttcaatcatataatatttccgggatgttgagacgcgggaaatacagccgcgccaac
cagaacggtcctgaagaatatggttttcgtggaaatgcgagaaactacgacctgaaccga
gattttattaaaaacgattcagaaaacgccaaagctttccagcagatcttccatcacttt
aagcccatttatttcattgacaatcatgtttctaatggcgcagattaccaatatttattc
acctatatttcgacgaataaagaacgtttaggaaaaactttgggaacttatttcaatgaa
aaaatgcagcccgaaattcttcaaactatcgaaaaacaaggaattctcaacacgccttat
gtcaatatccacggcgattctcctgatgaaggttttcctgcttttatggattcgccgcgc
tatgcgacgggttataccacgcttttcaacaccctcggtaccgttgcagaaacgcacatg
ttaaagccttacagtgaacgggtgcgtgcaacatacgaatacatgctgagttctatcaat
tatgtcgcgaaaaatgcttctgaaattcagaaaaagatgagcgaaagtctggccggttat
cagcccgggaagaaatatccaattcaatggaaatcagacaaaaacaaattcaaactgatt
gattttaaaggctatgaagccggaaaaaaaacaagcgtagtttcaggtaaaccccgctta
ttttacgacagaacgagaccttttacccgaaaagtgaaattttttaatgagtacatcgcc
acaaaagagatccggattccgaatttttatgtgattccgaaatcggaaaataaagtaatt
gaatacctcaagcgcaaccacatcgaaatgaaagagatcgggcaggattcaacggtgagt
gttgaactgtacaggattgccgattacaaaacagtgaaaaatccctacgaaggccattat
ctgcactacgacaccaaaattaaatctgagattaaaaacaagactttccgtaaaggcgat
tttttagtttccacaaagcagagcggcgtaaaatatttactggaaactttggagccggaa
gctacagattctttctttaactggaatttctttgatgcgattttgggccagaaagaatat
ttttcagactatgtttttgaagatactgcagcagagttacttaagaatgatcaggtactg
agaactgcgtttgaatttgaaaaaatatcaaacgccgattttgcgaaagacggcgcagcc
caactagaatggatttacaagcactctgattattatgagggaagtgtagggctgtacccc
atttaccgcatcctttaa

DBGET integrated database retrieval system