KEGG   Maribacter sp. HTCC2170: FB2170_00115Help
Entry
FB2170_00115      CDS       T01306                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FB2170_00115
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    FB2170_00115
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FB2170_00115
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FB2170_00115
Exosome [BR:fbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FB2170_00115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333586..334710
Genome map
AA seq 374 aa AA seqDB search
MKFEKIVLTCLAITLFNCKSSQIGEKKAIAPKNVILLISDGTGLSQISSAFYFKDSSPNY
ARFSDIGLINTSSSREDVTDSAAGATAFACGVKTYNGAIGVADDSTTVKNLVEIVSKKNI
KTGMIATSSITHATPASFFAHTFNRGSTEEIALHLTQSEVDFFAGGGLQFFNKRKDGRNL
LEALKEKKFMIDTTALVDFSKIRTNQKAGFLLAADDMPPAAEGRGDFLSKATSLALQFLS
KDDTGFFMMAEGSQIDWAGHQNNGPYLVSELIDFDDAIGKALDYAEKDGHTLVIVTSDHE
TGGFTLSAQIKKRADGTEYSDYSQVGMSFSNGGHSAALIPVFAFGPGSKEFIGVYENNDI
FEKILKVTKWRGQD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaaaaatagttttaacctgtctagcaattacgttgttcaattgtaagtca
agtcaaattggtgaaaaaaaggctattgcacctaaaaatgtaattctattgataagtgat
gggacaggattatctcagatttcttcagcgttctatttcaaagattcttcgcccaactat
gcccgatttagcgatataggtttaatcaacacttcctcttctagggaagacgttaccgat
tctgccgcaggggcgacggcttttgcatgtggggtcaaaacctataacggtgctatcggc
gtggccgatgattcgacaacggtgaaaaatttggtagagattgtttctaagaaaaacatc
aaaacgggtatgattgccacctcttctataacccatgcaacccctgccagtttttttgca
catacctttaatagagggtcaaccgaagaaattgcgctgcatctgacgcaatcagaagta
gattttttcgctggaggaggacttcagttttttaacaagaggaaagacgggcgaaacttg
ttggaggccttaaaagaaaaaaaattcatgattgataccacagctcttgttgatttttct
aaaataagaaccaaccaaaaagcaggatttcttttggctgcagatgatatgccacccgcg
gctgaaggtcgcggagactttctttcaaaagcaacttcattggcccttcaatttttaagc
aaagatgatacaggcttttttatgatggccgaaggttcccaaatagattgggcaggacat
caaaataatggaccatatctggtatctgaacttattgattttgatgatgccataggtaaa
gcattggattatgccgaaaaagatggccatactttggtcatcgtaacgtctgatcatgag
acagggggttttaccttatccgctcaaataaaaaaaagagcagatggtaccgagtatagt
gattatagccaagttggtatgtcattttcaaacgggggacattccgctgctttgattcct
gtatttgcttttggtcctggatcaaaagaatttattggggtctacgagaataatgacata
tttgaaaaaatattgaaagttacaaaatggagggggcaagactaa

DBGET integrated database retrieval system