KEGG   Maribacter sp. HTCC2170: FB2170_00115Help
Entry
FB2170_00115      CDS       T01306                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fbc00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:fbc00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:fbc02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333586..334710
Genome map
AA seq 374 aa AA seqDB search
MKFEKIVLTCLAITLFNCKSSQIGEKKAIAPKNVILLISDGTGLSQISSAFYFKDSSPNY
ARFSDIGLINTSSSREDVTDSAAGATAFACGVKTYNGAIGVADDSTTVKNLVEIVSKKNI
KTGMIATSSITHATPASFFAHTFNRGSTEEIALHLTQSEVDFFAGGGLQFFNKRKDGRNL
LEALKEKKFMIDTTALVDFSKIRTNQKAGFLLAADDMPPAAEGRGDFLSKATSLALQFLS
KDDTGFFMMAEGSQIDWAGHQNNGPYLVSELIDFDDAIGKALDYAEKDGHTLVIVTSDHE
TGGFTLSAQIKKRADGTEYSDYSQVGMSFSNGGHSAALIPVFAFGPGSKEFIGVYENNDI
FEKILKVTKWRGQD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaaaaaatagttttaacctgtctagcaattacgttgttcaattgtaagtca
agtcaaattggtgaaaaaaaggctattgcacctaaaaatgtaattctattgataagtgat
gggacaggattatctcagatttcttcagcgttctatttcaaagattcttcgcccaactat
gcccgatttagcgatataggtttaatcaacacttcctcttctagggaagacgttaccgat
tctgccgcaggggcgacggcttttgcatgtggggtcaaaacctataacggtgctatcggc
gtggccgatgattcgacaacggtgaaaaatttggtagagattgtttctaagaaaaacatc
aaaacgggtatgattgccacctcttctataacccatgcaacccctgccagtttttttgca
catacctttaatagagggtcaaccgaagaaattgcgctgcatctgacgcaatcagaagta
gattttttcgctggaggaggacttcagttttttaacaagaggaaagacgggcgaaacttg
ttggaggccttaaaagaaaaaaaattcatgattgataccacagctcttgttgatttttct
aaaataagaaccaaccaaaaagcaggatttcttttggctgcagatgatatgccacccgcg
gctgaaggtcgcggagactttctttcaaaagcaacttcattggcccttcaatttttaagc
aaagatgatacaggcttttttatgatggccgaaggttcccaaatagattgggcaggacat
caaaataatggaccatatctggtatctgaacttattgattttgatgatgccataggtaaa
gcattggattatgccgaaaaagatggccatactttggtcatcgtaacgtctgatcatgag
acagggggttttaccttatccgctcaaataaaaaaaagagcagatggtaccgagtatagt
gattatagccaagttggtatgtcattttcaaacgggggacattccgctgctttgattcct
gtatttgcttttggtcctggatcaaaagaatttattggggtctacgagaataatgacata
tttgaaaaaatattgaaagttacaaaatggagggggcaagactaa

DBGET integrated database retrieval system