KEGG   Maribacter sp. HTCC2170: FB2170_00940Help
Entry
FB2170_00940      CDS       T01306                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FB2170_00940
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FB2170_00940
   00640 Propanoate metabolism
    FB2170_00940
   00660 C5-Branched dibasic acid metabolism
    FB2170_00940
Enzymes [BR:fbc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FB2170_00940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(484983..486176)
Genome map
AA seq 397 aa AA seqDB search
MNLHEYQGKEILASFGVRIQRGIVAHSPKEAVDAAKQLTAETGTGWHVIKAQVHAGGRGK
GGGVKLAKNLQEVEEVAGNIIGMNLITPQTSAEGKKVHQVLIAEDVYYPGDSETSEFYMS
VLLDRGKGRNMIMYSTEGGMDIEEVAEKTPHLIFTEEVDPSTGLLPFQARKIAFNLGLSG
MAFKEMTKFVASLYKAYVESDSNMFEINPVLKTSDDKIMAVDAKVSIDDNALYRRKQYAE
MRDLREENPIEVEARAVGLSYVDLDGNVGCMVNGAGLAMATMDLIKMAGGEPANFLDVGG
TADAKRVEEAFRIILKDANVKAILINIFGGIVRCDRVAQGVVDAYKNMGDAITVPIIVRL
QGTNAELAKEIIDNSGLAVHSAVQFQEAADKVKEVLN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcacgagtatcaaggaaaagaaattttagcaagttttggtgtgcgtattcag
cgtggtattgtagcccatagcccaaaagaagcggtagatgcagccaagcagctaactgct
gaaacaggtacaggctggcacgtgataaaggcccaagtgcatgcaggtggtcgtggtaaa
ggcggcggagtaaaactggccaaaaaccttcaggaagtagaggaggttgctggtaacatc
atcggtatgaacttgattacgccccagacctcagctgaaggaaaaaaagttcaccaagta
ttgattgcagaagatgtttattatcccggagatagtgagacaagtgaattttacatgtcc
gttctactggatcgtggtaagggaagaaatatgattatgtattctaccgaaggaggtatg
gatattgaggaagtagccgaaaaaactccacatttgatatttaccgaggaagtggatccg
tctacgggccttttgcctttccaagctcgtaagattgcttttaatcttggtttgtcaggt
atggcctttaaagaaatgaccaaatttgtggcttcgctttataaggcttatgttgaaagt
gattctaacatgttcgaaataaatccggtattaaagacatcggatgacaagataatggcg
gtagatgcaaaggtgtctatagatgataacgcgttatatagaagaaagcaatacgcagag
atgcgtgatttaagagaagaaaatccaattgaggttgaagctagggctgtaggtttaagt
tatgttgatcttgatggaaacgttggctgtatggtgaatggcgctggcttggccatggca
acgatggatttgattaaaatggctggcggtgaacctgccaatttcttggatgttggtggt
acagcagatgccaaaagggtagaggaagcgtttcgcattattttaaaagatgccaatgta
aaagccatattaataaacatttttggtggcattgtaagatgtgatcgagtcgctcaaggt
gttgttgatgcttataagaacatgggggatgccattacggtaccgattattgttcgattg
caaggtacaaatgccgagttggcaaaggagattatagataattcaggtttggctgtacat
tctgcggttcaatttcaagaagctgctgataaagtaaaggaagttttgaattga

DBGET integrated database retrieval system