KEGG   Maribacter sp. HTCC2170: FB2170_01632Help
Entry
FB2170_01632      CDS       T01306                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00010  Glycolysis / Gluconeogenesis
fbc00051  Fructose and mannose metabolism
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01120  Microbial metabolism in diverse environments
fbc01130  Biosynthesis of antibiotics
fbc01200  Carbon metabolism
fbc01230  Biosynthesis of amino acids
Module
fbc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fbc_M00002  Glycolysis, core module involving three-carbon compounds
fbc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FB2170_01632
   00051 Fructose and mannose metabolism
    FB2170_01632
   00562 Inositol phosphate metabolism
    FB2170_01632
Enzymes [BR:fbc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     FB2170_01632
Exosome [BR:fbc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   FB2170_01632
  Exosomal proteins of bladder cancer cells
   FB2170_01632
  Exosomal proteins of melanoma cells
   FB2170_01632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: EAR00034
UniProt: A4AVV4
Position
complement(630920..631669)
Genome map
AA seq 249 aa AA seqDB search
MRSKIVAGNWKMNKNLAETEALVIELEAKLPNTDAEVMVSPTFVNLASAVSKLQGSKIKV
IAQNMHNAESGAYTGEISADMLLNIGIDTVILGHSERRAYFGETDEILATKVKAALAKNM
QIMFCFGEELNDRKSDNHFKVVESQLRNALFDLDPSAWSSIILAYEPVWAIGTGETASPE
QAQEMHAFIRKTIANAFNNEIAENVSILYGGSVKPGNAKEIFSKPDVDGGLIGGAALVAD
DFVAIINGI
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtaaaatagtagcgggaaattggaaaatgaacaagaacctcgcagaaacggag
gctttggttatagagttagaagcaaaattacctaatacagatgctgaggtaatggtgtca
ccaacatttgtgaatttagccagtgctgtaagcaagctccagggttcaaaaataaaggtc
attgcccaaaatatgcacaatgctgaaagtggagcatatactggcgagatttctgcagat
atgttgttgaacataggtattgataccgtgatcttgggtcattcagaaagaagagcctat
tttggtgagaccgatgagattttggcaacaaaggtaaaagcggctttggcaaagaatatg
cagataatgttctgttttggagaggaattgaatgatcgtaaatctgacaatcattttaaa
gtagtggaaagccagttacgtaatgcgttgttcgatttggatccaagcgcatggagtagt
atcatactggcctacgagcccgtttgggccattggtaccggtgaaacggcatctccggaa
caagctcaagaaatgcatgcctttattagaaagaccattgcaaacgccttcaataatgag
atagcagaaaatgtttctatcttatatggtggtagtgtaaaaccaggtaatgcgaaggag
attttctcaaaaccagatgttgacggtggccttatagggggagcggcattggttgcagat
gatttcgtcgcgattatcaatggaatttag

DBGET integrated database retrieval system