KEGG   Maribacter sp. HTCC2170: FB2170_01647Help
Entry
FB2170_01647      CDS       T01306                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fbc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
633475..634296
Genome map
AA seq 273 aa AA seqDB search
MTLNCKGNLIDLTTPKVMGILNITPDSFYDGGKYENDTSILEQVEKMLSEGAIFIDVGAY
SSRPGADHITENEEKDRIVPVIRSIIKRFPEAILSIDTFRSTVASACLNEGASIINDISA
GKQDDKMFEIVAQHQAPYIMMHMKGTPKNMQQNTNYKNLMTDILYYFSERLSEARAHKIN
DIIIDPGFGFSKTLEQNYELLRKMDLLNTLELPILVGVSRKSMIYKTLDVTPQEAMNGTT
ALNMIALQKGAKILRVHDVAEAIECITLNEHLN
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccctaaattgtaaaggaaacttaattgacttaaccacacctaaagtcatgggcata
ctcaatattaccccagattctttttatgatggaggaaaatatgaaaatgacacatccata
cttgagcaggttgaaaaaatgctttctgaaggagcgatctttatagacgttggtgcatac
agttcacgacctggagcagaccatatcaccgaaaatgaagaaaaagacagaatagttccg
gttataaggtccattataaaacgatttcccgaagcaatactttctattgacacttttcgc
agtacagttgcctcagcatgtctcaatgaaggagcatcaataatcaatgacatttcagct
ggaaaacaagatgataaaatgtttgagatcgtagcgcaacaccaggccccttatataatg
atgcatatgaagggtacaccaaagaacatgcaacaaaataccaactacaagaacttgatg
acggatatactatattatttttcagaaagattgtcagaggcaagggcacataagatcaat
gatataatcatagatcccggatttggattcagtaaaaccctagaacaaaattatgagttg
ttacgaaaaatggatttattgaatactttggaattacctattttggtcggagtaagcaga
aaatcaatgatttacaaaacattggacgtgacaccacaggaggcaatgaatggcacaact
gcgttgaatatgatcgcgctgcaaaaaggtgccaagattttacgtgttcatgacgttgcc
gaagccattgaatgtattacattaaatgaacatttgaactga

DBGET integrated database retrieval system