KEGG   Maribacter sp. HTCC2170: FB2170_01906Help
Entry
FB2170_01906      CDS       T01306                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00010  Glycolysis / Gluconeogenesis
fbc00520  Amino sugar and nucleotide sugar metabolism
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01120  Microbial metabolism in diverse environments
fbc01130  Biosynthesis of antibiotics
fbc01200  Carbon metabolism
Module
fbc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FB2170_01906
   00520 Amino sugar and nucleotide sugar metabolism
    FB2170_01906
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     FB2170_01906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Tex_YqgF
Motif
Other DBs
NCBI-ProteinID: EAQ99675
UniProt: A4AWR1
Position
689746..690495
Genome map
AA seq 249 aa AA seqDB search
MVVLGIDIGGSGMKGALVNSLTGEMLTERHRIPTPPTRKPKEMAEVVKQLVEHFNHKGPV
GVGFPTVIKHGICKSPGNLHKKWLNVNVHELFSEVTGLPVTVINDADAAGYATMNYGIGK
GKEGFVLMITIGTGLGSGAFLDGELIPNMELGQIPYKKYKKIELWAAASAKEREGLSYKE
WGKRFNTFLKLVDLIISPDLIILGGGTSKKFDQYKEYITIDTPVIPAELRNEAGIIGAAA
AALHQAPKD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggtagttctcggtattgatataggaggttctggaatgaaaggagccttggtaaattcg
ttaacaggtgaaatgttgactgaaaggcataggattcccactccaccaacaagaaagccg
aaagaaatggccgaagttgtaaaacaattggtagagcactttaatcataaaggacctgtg
ggtgttggttttccaacagtaatcaagcacggaatttgtaaatctccaggaaatcttcat
aaaaaatggctgaatgtaaatgtacacgagttatttagtgaagttacgggcttacctgtt
actgttattaatgatgccgatgcggctggatatgccacaatgaactatggcataggaaaa
ggcaaagaaggttttgtgttaatgattaccattggtacaggtttaggcagtggtgcattt
ttagatggagaattgatcccgaatatggaacttggtcaaataccgtataaaaaatataag
aaaattgaattatgggcagcggcttctgctaaagaacgtgaaggactatcttataaagaa
tggggcaaacgattcaacacatttttaaagttagtcgacttgattatttcaccagattta
ataatcttgggcggtggaacttctaaaaaattcgatcagtataaagagtatataactatt
gacacccctgtaattcctgcagaacttcgtaatgaagccggtattattggagctgccgcg
gcggctttgcatcaagcaccaaaagactga

DBGET integrated database retrieval system