KEGG   Maribacter sp. HTCC2170: FB2170_01906Help
Entry
FB2170_01906      CDS       T01306                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FB2170_01906
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FB2170_01906
   00520 Amino sugar and nucleotide sugar metabolism
    FB2170_01906
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     FB2170_01906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689746..690495
Genome map
AA seq 249 aa AA seqDB search
MVVLGIDIGGSGMKGALVNSLTGEMLTERHRIPTPPTRKPKEMAEVVKQLVEHFNHKGPV
GVGFPTVIKHGICKSPGNLHKKWLNVNVHELFSEVTGLPVTVINDADAAGYATMNYGIGK
GKEGFVLMITIGTGLGSGAFLDGELIPNMELGQIPYKKYKKIELWAAASAKEREGLSYKE
WGKRFNTFLKLVDLIISPDLIILGGGTSKKFDQYKEYITIDTPVIPAELRNEAGIIGAAA
AALHQAPKD
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggtagttctcggtattgatataggaggttctggaatgaaaggagccttggtaaattcg
ttaacaggtgaaatgttgactgaaaggcataggattcccactccaccaacaagaaagccg
aaagaaatggccgaagttgtaaaacaattggtagagcactttaatcataaaggacctgtg
ggtgttggttttccaacagtaatcaagcacggaatttgtaaatctccaggaaatcttcat
aaaaaatggctgaatgtaaatgtacacgagttatttagtgaagttacgggcttacctgtt
actgttattaatgatgccgatgcggctggatatgccacaatgaactatggcataggaaaa
ggcaaagaaggttttgtgttaatgattaccattggtacaggtttaggcagtggtgcattt
ttagatggagaattgatcccgaatatggaacttggtcaaataccgtataaaaaatataag
aaaattgaattatgggcagcggcttctgctaaagaacgtgaaggactatcttataaagaa
tggggcaaacgattcaacacatttttaaagttagtcgacttgattatttcaccagattta
ataatcttgggcggtggaacttctaaaaaattcgatcagtataaagagtatataactatt
gacacccctgtaattcctgcagaacttcgtaatgaagccggtattattggagctgccgcg
gcggctttgcatcaagcaccaaaagactga

DBGET integrated database retrieval system