KEGG   Maribacter sp. HTCC2170: FB2170_02175Help
Entry
FB2170_02175      CDS       T01306                                 

Definition
di-haem cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fbc  Maribacter sp. HTCC2170
Brite
Enzymes [BR:fbc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     FB2170_02175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(758550..759728)
Genome map
AA seq 392 aa AA seqDB search
MRSLLLFILLFVSVFSLLGCSDSKTKKISNKPVKKVSTTISALPKQVMDPKGNVNSFEKI
ELGRLLFFDPILSGNKDVACATCHHPSTGYAEFLDISIGANAKGFGSKRKFNSPNDIPFV
KRNAQTIINTAFNGINTYNKYNPGDAPMFWDDRVKSLEKQALEPIKAFEEMRGHGFSESE
ILEEVVSRLNQIPEYRELFNTAFGDANISIENLGKAIAAFERSLITNNSRFDQFMRGDND
AILISEKEGFELFKKVGCVNCHNGPMFSDYKVHVLGVPQNSKLELPDAGVKDSFGFRTPS
LRNLRYTAPYMHNGSLKTLKRVLEFYEDIANGKSRNPLVPKEKFDPFVRELELSVKEMSL
IISFLNTLNDDDFDKSIPEKVPSGLSVGGNIH
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagaagtttacttttattcatattgttatttgtttcagtgttcagtttattgggatgt
tctgattcaaaaactaaaaaaatatccaataagcccgttaaaaaggtttctactactata
tcggccctgccaaaacaggtaatggacccaaaaggcaatgtgaattcgtttgaaaaaatt
gaacttgggcgattattgttttttgatccaattctttcaggaaataaagatgtggcttgt
gccacttgtcatcaccctagtactggttatgccgagtttttggatatttcaatcggtgcg
aatgcgaaaggttttgggagcaaacgaaaattcaattctccaaacgatataccatttgtt
aaaagaaacgcgcaaaccattattaatacggcgtttaacggaataaatacatataacaag
tataatcctggagatgctccaatgttttgggatgaccgggttaagagcctagagaaacag
gctttggagccaataaaggcctttgaagaaatgcgaggtcacgggttttctgaatctgag
attttggaagaagtagttagtaggttgaatcaaattcctgaatatagagaattgttcaat
actgctttcggggatgctaatatttcaattgaaaatctaggaaaggctattgcggcattt
gagcgtagtttaataacaaataattcgcgctttgatcaatttatgcgaggggataatgat
gctattctcatttctgagaaagaaggctttgagcttttcaaaaaagtaggttgtgtaaac
tgtcataatggtcccatgttctctgactataaagttcatgtccttggagttccccaaaac
agtaaattagagttgccagatgcgggtgtaaaggatagttttgggtttaggacaccatct
ttgagaaatctaagatatactgcgccatatatgcataatggtagcctaaagactttgaaa
agagtgttggagttctatgaagatatagccaacggaaaaagcagaaaccctctggttcca
aaagaaaagtttgacccgtttgttcgtgaattagagcttagtgtcaaagaaatgtcgttg
ataatttcttttttgaatacattgaacgatgatgattttgataagtcgattcctgaaaaa
gtgccaagcggactttctgtgggtggaaatattcattaa

DBGET integrated database retrieval system