KEGG   Maribacter sp. HTCC2170: FB2170_03270Help
Entry
FB2170_03270      CDS       T01306                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FB2170_03270
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FB2170_03270
  Amino acid metabolism
   00310 Lysine degradation
    FB2170_03270
Enzymes [BR:fbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FB2170_03270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(995837..997051)
Genome map
AA seq 404 aa AA seqDB search
MILEMKVPSPGESITEVEIAEWLVEDGDYVEKDQAIAEVDSDKATLELPAEESGTITLKA
EEGDAVAVGAIVCLIDTSAPKPEGESSDKIVTVETKTIEATSKVVAETKETYATGAASPA
AKKILAEKNIDGATIKGTGKDGRITKEDAVKAVPSMGTPLSGGNRGETRSKLSMLRRKVA
ERLVSAKNETAMLTTFNEVDMSPIFALRKKYKENFKEKHGVSLGFMSFFTKAVVRALEMY
PAVNSMIDGKEMISYDFADISIAVSGPKGLMVPVIRNAEKLTFRGVEAEVKRLAIRARDG
EITVDEMTGGTFTITNGGVFGSMLSTPIINPPQSAILGMHNIVERPIAKNGEVVIAPIMY
VALSYDHRIIDGKESVGFLVAVKEALESPEELLMDNDVKKALEM
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattttagaaatgaaagtcccttcaccgggcgagtcgattaccgaagttgaaattgcg
gaatggttggttgaagatggtgattatgttgaaaaagaccaggcaattgctgaggttgat
tccgacaaggcaacattagaacttcctgctgaggaaagtggtactattactttaaaagct
gaagagggtgatgccgtggccgtgggggctatagtttgtttgatagatacttctgcgcca
aagcctgaaggtgaatcctcagataaaattgtaacagttgaaactaaaaccatagaagct
acttctaaggtggtcgcagaaacgaaagagacttatgcaacaggtgccgcctctcctgca
gcaaagaaaatattagcggaaaaaaatattgatggcgctaccataaaaggtacaggtaag
gatggtagaatcaccaaggaggatgcagtaaaagcggtaccatcaatgggtacaccttta
tctggtggtaatcgcggggaaacccgttcaaagctttctatgttgcgaagaaaagtagca
gaaagattggtttcggctaagaacgaaactgcgatgttaaccacttttaatgaagtggat
atgtcaccgatttttgcccttcgaaaaaaatataaagagaattttaaagagaaacacgga
gttagtttaggtttcatgtcattttttacaaaggcagttgtgagggcattggaaatgtat
cctgctgttaattcaatgattgatggtaaggaaatgatctcttacgattttgctgatata
agtattgccgtctcaggaccaaaaggattaatggtgccggttattcgaaatgctgaaaag
ttgacctttaggggtgttgaagctgaggtaaaacgattggctattcgagcacgggatggt
gaaattacagtcgatgaaatgaccggaggtacattcacgattacaaatggaggtgttttt
gggtccatgttgtctacgccaataataaacccacctcaaagcgcgatattgggaatgcac
aatattgtggaaagacctatcgctaaaaacggagaagttgtaattgcgcctattatgtat
gtagcattgtcatatgatcacaggatcattgacggaaaagaatctgtaggatttttggtt
gctgtaaaagaggcattggaaagtccagaagaactgttgatggataacgatgtgaagaag
gcgcttgaaatgtaa

DBGET integrated database retrieval system