KEGG   Maribacter sp. HTCC2170: FB2170_04590Help
Entry
FB2170_04590      CDS       T01306                                 

Definition
CysQ, sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    FB2170_04590
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     FB2170_04590
Transfer RNA biogenesis [BR:fbc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    FB2170_04590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295399..1296193
Genome map
AA seq 264 aa AA seqDB search
MNNYLRIALKSAVEAGKEILKIYENEFEISIKEDKSPLTEADIASSDIINSYLKPTGFHI
ISEEIRNLEFDIRKDWKTCWIVDPLDGTKEFIKRNGEFTVNIALVENGIPKMGVIYVPVT
RELYYADVSKGKAYKTLLNNAHETDGSYFNDNDLITPIEDDKEMIKVVGSRSHMNKDTLK
FIEELKNEYRGIDIVSKGSSLKFCLVAEGKADIYPRLAPTMEWDTAAGHAICSAVGLTVI
SKETNKELAYNKKDLLNSHFIVKK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaataattatctcagaattgcattaaaaagtgcagttgaagcgggcaaagaaattcta
aaaatttacgagaatgaatttgaaatcagcatcaaggaagataaatcacctcttacagaa
gccgatatagcctctagtgacattatcaatagttatttgaagcccactgggtttcacata
atcagtgaagaaattaggaacctggaatttgacataaggaaagattggaaaacttgttgg
atagttgaccctttggatggaactaaggaattcatcaaaagaaatggagagtttacagta
aacattgcattagtcgaaaatggcataccaaaaatgggggttatttatgtacctgttacc
agggaactctattatgcggatgtttccaaaggtaaagcatacaaaacattgttaaacaat
gcccatgaaactgatggatcatattttaatgataatgatctaattactccaatagaagat
gataaagaaatgataaaggtcgtgggaagccgttcgcatatgaacaaagacactcttaag
tttatcgaagagttaaaaaatgaatatagaggaatagatattgtttcgaaaggaagttct
ttaaaattttgccttgtagcagagggtaaagctgatatttatccaaggcttgctccaaca
atggaatgggatacagctgccggtcatgccatctgcagtgctgtaggacttactgtgatt
tctaaagaaacaaataaagaattagcatacaacaagaaagatttattaaacagtcacttc
atcgtaaaaaaataa

DBGET integrated database retrieval system