KEGG   Maribacter sp. HTCC2170: FB2170_04590Help
Entry
FB2170_04590      CDS       T01306                                 

Definition
CysQ, sulfite synthesis pathway protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:fbc00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295399..1296193
Genome map
AA seq 264 aa AA seqDB search
MNNYLRIALKSAVEAGKEILKIYENEFEISIKEDKSPLTEADIASSDIINSYLKPTGFHI
ISEEIRNLEFDIRKDWKTCWIVDPLDGTKEFIKRNGEFTVNIALVENGIPKMGVIYVPVT
RELYYADVSKGKAYKTLLNNAHETDGSYFNDNDLITPIEDDKEMIKVVGSRSHMNKDTLK
FIEELKNEYRGIDIVSKGSSLKFCLVAEGKADIYPRLAPTMEWDTAAGHAICSAVGLTVI
SKETNKELAYNKKDLLNSHFIVKK
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaataattatctcagaattgcattaaaaagtgcagttgaagcgggcaaagaaattcta
aaaatttacgagaatgaatttgaaatcagcatcaaggaagataaatcacctcttacagaa
gccgatatagcctctagtgacattatcaatagttatttgaagcccactgggtttcacata
atcagtgaagaaattaggaacctggaatttgacataaggaaagattggaaaacttgttgg
atagttgaccctttggatggaactaaggaattcatcaaaagaaatggagagtttacagta
aacattgcattagtcgaaaatggcataccaaaaatgggggttatttatgtacctgttacc
agggaactctattatgcggatgtttccaaaggtaaagcatacaaaacattgttaaacaat
gcccatgaaactgatggatcatattttaatgataatgatctaattactccaatagaagat
gataaagaaatgataaaggtcgtgggaagccgttcgcatatgaacaaagacactcttaag
tttatcgaagagttaaaaaatgaatatagaggaatagatattgtttcgaaaggaagttct
ttaaaattttgccttgtagcagagggtaaagctgatatttatccaaggcttgctccaaca
atggaatgggatacagctgccggtcatgccatctgcagtgctgtaggacttactgtgatt
tctaaagaaacaaataaagaattagcatacaacaagaaagatttattaaacagtcacttc
atcgtaaaaaaataa

DBGET integrated database retrieval system