KEGG   Maribacter sp. HTCC2170: FB2170_04940Help
Entry
FB2170_04940      CDS       T01306                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FB2170_04940
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FB2170_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1385630..1386223)
Genome map
AA seq 197 aa AA seqDB search
MKGGKLIIFSAPSGSGKTTIVKHLLKQPELNLAFSVSATSRARRGKEKDGEHYYFLHVSE
FKKHIKNDNFLEWEEVYRDNFYGTLKSEVERLWAEGKNVIFDIDVVGGLRIKKKFPKETL
AVFVKPPSVDELKIRLKKRSTESDDKINMRIAKASVELATAPQFDIIINNYDLETALNEA
HTLVADFVGADKSINEE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtggtaagttaattattttttctgccccttcaggtagcggcaagacgaccatt
gtaaagcatcttttaaaacagccagaacttaatttggctttctcggtatctgcaacttca
agagctaggagaggaaaagaaaaagacggggaacattactattttcttcatgtttcagaa
tttaaaaaacatattaagaatgataactttttagagtgggaagaagtataccgtgataac
ttttacggcacgttaaaaagtgaagttgagcgcctttgggctgaagggaaaaatgtgatt
tttgatattgacgtggtcggaggtttacgaataaaaaagaaattccctaaggaaacgttg
gcagtatttgtaaagcccccaagtgttgatgaactgaagattcgattgaaaaaacgcagt
accgaaagtgatgacaagataaatatgcgaattgctaaagcctctgttgagcttgccaca
gcaccacaatttgatataataataaataattacgatttggagacggctcttaatgaggcc
catacactggtcgcggattttgttggcgctgataaatcgataaacgaggagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system