KEGG   Maribacter sp. HTCC2170: FB2170_05200Help
Entry
FB2170_05200      CDS       T01306                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fbc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444338..1445327
Genome map
AA seq 329 aa AA seqDB search
MYPIIRNRRLRANESIRRLVRETTIGPDDFLVPLFVVEGKGIKEEIASMPNYYRLSLDNL
DKEVKELWKMGLCSVLLFVKVPDNLKDNKGTEALNADGLMQRAIKTVKNACPEMLVMTDV
ALDPFSSYGHDGIVADGQILNDETTEVLAEMSVSHAEAGADFVAPSDMMDGRILTIREAL
EEEGYINTGIMSYSAKYASSFYGPFRDALDSAPVDIKNVPKDKKTYQMDFANRFEAIRET
QMDIDEGADIVMVKPGIAYLDIIREIRNEVDVPIAVYQVSGEYAMLKAAAEKGWLDHDAV
MIEQLLAIKRAGANIIASYFAKDVIRVLE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtatccaatcataagaaatagaaggcttcgcgccaatgaatcaatacgcaggttagtc
cgggaaacaaccattggccctgatgactttcttgtacctctttttgtggttgaaggaaaa
ggaatcaaagaagaaatagcttccatgcccaattattataggttaagccttgataatctt
gataaagaagtcaaagagttgtggaaaatgggactttgctcagttttgctgtttgtaaaa
gtaccagacaacctcaaagacaataagggaacagaggctttaaatgccgatggtctaatg
caacgtgcaataaaaacagttaagaatgcctgcccagaaatgttggtcatgactgatgta
gccttagatcctttttcatcttacggacatgacggaattgtagcagacggacaaatattg
aacgatgaaaccactgaggtcttggcagaaatgagcgtatcccatgctgaggcgggagct
gattttgtggccccaagtgatatgatggatggaaggattctgaccataagagaggctttg
gaagaagaaggttatatcaatactgggattatgagttatagtgcaaaatatgcgagctca
ttctatgggccttttcgtgatgcactggattcggcacctgtagatattaaaaacgtgcct
aaagacaagaagacctatcaaatggattttgccaacagatttgaagcgattcgtgaaacc
caaatggatattgatgaaggtgctgacattgtcatggtaaaaccgggaatcgcctatctg
gatattattcgtgaaataagaaatgaggttgatgtgcctattgcagtataccaagtatct
ggtgaatatgccatgttaaaagctgcggctgaaaaaggttggttagatcatgatgcagtt
atgattgaacaactcctggcaatcaaaagagctggtgcgaatatcatcgccagttacttt
gccaaagatgttattcgtgttttggagtaa

DBGET integrated database retrieval system