KEGG   Maribacter sp. HTCC2170: FB2170_05805Help
Entry
FB2170_05805      CDS       T01306                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:fbc00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:fbc00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1567526..1568065)
Genome map
AA seq 179 aa AA seqDB search
MKITPTKIKDCLLLEPNVFEDERGSFIESFKKQNLENALGFKIDFVQDNISISKKWVLRG
LHFQINDYSQAKLINVVRGRVLDVVVDLRKDSATYGQHFKIELDSIDRKLLFIPKGMAHG
FLSLADDTIFSYKCDAYYNQAAEGGIFYNDPDLAIDWEYPGNRFILSEKDLQLTPFKTI
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataacaccaacaaaaatcaaagattgcctattgctggagccaaatgtttttgaa
gacgaaaggggctcttttatcgagtcctttaaaaaacaaaatctagaaaacgccctaggt
ttcaaaattgattttgttcaggataatatttctatttctaaaaaatgggttttgaggggg
ttgcattttcaaatcaatgattatagccaagcaaaactcattaatgtggtaaggggtagg
gttttggatgttgtggtcgaccttagaaaagatagtgcgacttatggccaacattttaaa
atagaactggattcgatagacagaaaactgctttttataccaaaaggtatggcacatgga
tttttaagtctggctgatgatactattttttcatataagtgtgatgcctattataatcag
gcggctgaaggaggtatcttttataatgaccctgaccttgcaatagactgggaataccct
gggaataggtttattttatcggaaaaagatttacaattaaccccctttaaaaccatatga

DBGET integrated database retrieval system