KEGG   Maribacter sp. HTCC2170: FB2170_06640Help
Entry
FB2170_06640      CDS       T01306                                 

Definition
ROK family member transcriptional repressor
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FB2170_06640
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FB2170_06640
   00052 Galactose metabolism
    FB2170_06640
   00500 Starch and sucrose metabolism
    FB2170_06640
   00520 Amino sugar and nucleotide sugar metabolism
    FB2170_06640
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FB2170_06640
   00524 Butirosin and neomycin biosynthesis
    FB2170_06640
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FB2170_06640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1775007..1775936
Genome map
AA seq 309 aa AA seqDB search
MKKDIAIGVDVGGSHIVSAAVNLKTNEIILATTHSVKVNNKESKDVVLENWSRAINETIE
SAGIVNTTNIGFAIPGPFNYKSGVAMFEGDNDKYESLYKVSIPEELPKYINSDEVDLRFL
NDATSFGVGVSKQGKAKLYSKVIVVTLGTGFGSAFIENGIPQVHSDEVPEGGCLWDKPFK
SGISDDYFSTRWCINRYEELTGEKLLGVKEVAMVNNPHSKAVFDEFGLNMATFMMPFIER
FKADIIVMGGNISKASELFLPTFEKKMLDYGSRVEIEISNLMEDAAILGSAKLFDPVFWQ
SVKDELPEL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagatatagccattggagttgatgttggcggaagtcatattgttagtgctgcc
gtgaacctgaaaaccaatgaaataattctggcgaccactcattctgtcaaagtaaacaac
aaggaatccaaggatgttgtattagaaaactggagcagagctattaacgagaccattgaa
agtgctgggattgtaaatacaactaatattgggtttgctattccaggaccttttaattac
aaaagcggagtggcgatgttcgaaggtgataatgacaaatatgagagcttgtataaagtt
tcgatacccgaagaattacctaaatatatcaatagtgatgaagttgatttaagattttta
aacgatgctacttcctttggtgttggcgtatcaaaacaaggaaaagcgaaattgtatagc
aaagtgattgttgtaacgttgggcacggggtttggttctgcttttatcgaaaatggcatc
ccgcaagtacatagtgatgaagtacccgagggaggatgtttgtgggataaaccatttaaa
tctggtattagtgatgactatttttctacgcgatggtgcataaacaggtacgaggagctt
acaggggaaaagttactaggtgttaaagaggtggcaatggtgaataatcctcattcaaaa
gcagtttttgacgaatttggtttgaacatggcaacgttcatgatgccttttattgaaagg
ttcaaagcggatattattgtaatgggaggtaatatttcaaaggcaagcgagctatttcta
ccgacttttgaaaagaaaatgttggattatgggtcacgggttgaaattgaaatatcgaac
ttaatggaagatgccgctatattgggtagtgctaagctatttgaccctgttttttggcaa
tcggtgaaagacgaattacctgaactttaa

DBGET integrated database retrieval system