KEGG   Maribacter sp. HTCC2170: FB2170_06875Help
Entry
FB2170_06875      CDS       T01306                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    FB2170_06875
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     FB2170_06875
Exosome [BR:fbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FB2170_06875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1826497..1827984
Genome map
AA seq 495 aa AA seqDB search
MSKKYIISLDQGTTSSRALLVDQEGAIVNMVQQEFKQIFPKPGWVEHDPKEIMESQLHVM
HELVKKENIDASDIKAIGITNQRETTMVWDKNTGEPVYNAIVWQDKRTADICEDLKIKGL
VEHVKMTTGLVIDSYFSGTKVKWILDNVEGTRERADNGDLLMGTVDTWLVWNMTKGKSHV
TDYTNASRTMIYDITKLTWDEKMLGELGIPKSMLPEAKPSAHHFGDYELNGVSIPIAGIA
GDQQAALFGQGCFAKGTAKNTYGTGCFMLMNTGEKPQFSDNGLLTTIAYGLNGKVNYAFE
GSIFIAGAAIQWLRDGLELIKDAKETEALANSIEGESSVYVVPAFAGLGAPYWDMYARGA
IFGLTRDTGKAHLAKATLESLAYQTKDILNAMEEDSGVELQNLKVDGGACANNYLMQFQA
DILGTEVHRPKVIESTAMGAAFLAGIQVGLWTQNDIDQSRPMDRIFKPTFDSDKRTRLYK
TWQKAVDRTKGWEEN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaaatatatcatttccctggatcaaggaacaacaagctcacgagctctattg
gttgatcaagaaggtgccatcgtaaatatggtgcaacaagaattcaaacagatttttcca
aaaccaggctgggtcgaacatgaccccaaggaaattatggaatcgcagttacatgtgatg
catgaattggtaaaaaaagaaaatattgatgcttcagacattaaggcaatcggaattacc
aatcagcgggaaactacgatggtttgggataaaaataccggcgagcctgtttacaacgct
atcgtttggcaagacaaacgtactgcagatatttgtgaagacctcaagatcaaaggactt
gttgaacatgtgaaaatgacaacaggattggtgatcgattcctatttttcgggcaccaag
gtgaaatggatactggataatgttgagggtactcgagaaagagctgataatggagatttg
ttaatgggtacggtcgacacttggttggtttggaatatgaccaaggggaaaagtcatgtt
accgattatacaaacgcatcacgaaccatgatatatgatattaccaagcttacttgggat
gaaaaaatgttgggtgaattgggaatcccaaaaagtatgttgccagaggccaaaccctct
gcgcatcattttggagattatgaattaaatggggtaagtattcccatagcaggaattgct
ggtgatcaacaggcagctttgttcggtcaaggatgttttgccaagggaactgctaaaaat
acctacgggacaggatgttttatgctgatgaacacgggtgagaaaccacaattttcagat
aacggactactcactacaatcgcttacggattgaatggaaaagtaaactatgcctttgaa
ggaagtatttttattgccggagcagcaattcaatggttaagagacggcttggaacttatc
aaagatgccaaggagactgaagcattggcaaattctattgaaggtgaaagctcagtctat
gttgttcccgcctttgctggattgggcgcaccatattgggatatgtatgcccgtggagcc
atttttgggttgacccgcgatactggtaaagcccatttggcaaaagcaacgctcgagtca
ttggcataccagaccaaggatattctaaatgccatggaggaagattcaggagtagagctt
caaaatttaaaagtagatggtggggcctgtgccaacaattatctaatgcaatttcaagcg
gatattttggggactgaagtccatcgacctaaggttatagaatccacagcaatgggtgcc
gcatttttagcaggaatccaagtagggttatggactcagaatgacattgatcagagtagg
ccaatggaccgtatattcaaacctacttttgacagtgacaaaagaacacggttatataaa
acctggcagaaagcagttgaccgcacaaaaggttgggaagagaattag

DBGET integrated database retrieval system