KEGG   Maribacter sp. HTCC2170: FB2170_07739Help
Entry
FB2170_07739      CDS       T01306                                 

Definition
putative uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FB2170_07739
Enzymes [BR:fbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     FB2170_07739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2000955..2001701)
Genome map
AA seq 248 aa AA seqDB search
MKIKTILVSQPEPKMENSPYSRLIDKEKVKVDFRPFIHVEGVDAKAVRQQKIDLHNYTAI
ILTSRNAVDHFFRIADEMRFKVPDSMKYFCQSEAVAYYLQKYVVYRKRKIYVGKRNFNDL
VPLFKKYKEEKFLLPSADVLKQEVPEKLDELDVEWTRGIFYKTVISDLSDLRDVYYDVLV
FFSPSGIESLLKNFPDFEQNDTRIAVFGNSTVAAATGAGLRIDIKAPTPDTPSMTMALQK
YITTINKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataaagacgattttggtatcgcagcctgaacctaaaatggagaactctccatat
tccagactaattgacaaggaaaaagtaaaagttgactttagaccattcattcatgttgaa
ggggttgatgctaaagcggttcgccaacaaaagatagatttacacaattatactgcgatt
attttgaccagtagaaatgcggttgatcacttcttcagaattgctgatgaaatgcgtttc
aaagtacctgactctatgaagtatttttgtcagtctgaagcggttgcttattacctacag
aaatacgtggtgtatcgcaagcgtaagatttatgttggcaaaagaaattttaatgacctt
gttcctttatttaaaaaatataaagaagagaagtttcttttaccgtctgcagacgttcta
aaacaagaagttcctgaaaaattagatgaattggatgttgaatggacaagaggtattttc
tataaaacagtgatcagtgacctttcagatttaagagatgtttattatgatgtattggtc
ttctttagcccttctggtatagaatccttactaaagaactttcctgactttgagcaaaat
gacacgcgtattgcagtcttcggaaattctacggttgcagctgctaccggagcaggactt
cgaatagatattaaagcccctacgcccgacacaccgtcgatgacaatggcgctccaaaag
tatataactacaataaacaagaaataa

DBGET integrated database retrieval system