KEGG   Maribacter sp. HTCC2170: FB2170_08269Help
Entry
FB2170_08269      CDS       T01306                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fbc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fbc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2126806..2127570)
Genome map
AA seq 254 aa AA seqDB search
MKKKRILLKIGSNTLTKETNHISRGKIEDIGRQIAHLKDDYEFIIVSSGAIAAAKQFVKL
EHNGEEINVKQALAAIGQPHLMRIFQENFRELGLFTSQCLLSYSDFEKEESKINIKNTIN
VLVSNNFIPIINENDTVATDEIKFGDNDKLAALTASLLKVDLLLIATNTDGIYTKASIKN
NTPETITSVKNLASLSNEVSIGKSSHGTGGMQSKIEAATIAQKVGIETWIVNGLQDSFIL
NALNNTNNFTKIIA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaagagaattttacttaaaataggttccaataccttaaccaaagaaactaat
catatttctaggggtaagattgaggatattggtcgacaaattgcccatttaaaggatgat
tacgagtttattatcgtgagttccggggcaatcgctgcagcaaaacagttcgtgaagttg
gaacataacggtgaggaaatcaatgtaaaacaagccttggctgcaattggtcaaccacat
ctaatgcgcatttttcaggaaaactttagggaactaggattatttacctctcagtgctta
ttgtcctattccgactttgaaaaagaagagtcaaaaataaatataaagaacacgatcaat
gtattggtgagcaataacttcattcccataatcaacgaaaatgacacggttgccactgat
gaaatcaaatttggggacaatgataaattggcagcacttactgcatctttactcaaagtt
gatttgttattaattgccaccaatactgatgggatttacaccaaagcctcaattaaaaat
aacactcctgaaaccataacctctgtgaaaaatttggcatccctgagcaacgaggtaagc
ataggaaaatcgagtcatggtaccggcggaatgcaatccaaaatcgaagccgcaactatt
gcccaaaaggttggaatagaaacttggattgtgaacggactccaggacagttttatcctg
aatgctttaaataataccaataattttacaaaaataatcgcatga

DBGET integrated database retrieval system