KEGG   Maribacter sp. HTCC2170: FB2170_09816Help
Entry
FB2170_09816      CDS       T01306                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FB2170_09816
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     FB2170_09816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2476868..2478598
Genome map
AA seq 576 aa AA seqDB search
MRNKVLGVGLLTLLIIGLCIGCAGKQFPPDDNEYSDQIRLNQIGYYPNAVKKAVIVEVKG
ATDFSIVDRKTMYSVFEGKLSEQISWELSGEKVQIANFSDLTKTGKYILYIDCLGYSYPF
EIRNNVLDQVFLGSVKAMYYQRMSTPLEEEFAGKWHRPMAHPDDNVSYHPSSGRNEGFLN
SPGGWYDAGDYNKYVVNGSFPLGQFLSFHEQYPNTLKDNSLNIPESGNGTSDYLDELKYE
MDWLLTMQDDDGGLFHKLTALNFQGMVMPHEATAKRYVVGKGTAASLDFSACAAKAYRVF
KEIDANYAHKCLEASKRAYAWALENPDVEYLNPEIVSTGQYGDKDFLDEWFWANAELYIS
TGENEYLKKLTESDFNFEFVPGDNWTKFMRFMGMFALLDNKETLSSQIFESLKKGIILEA
DKLVERSNSLAYFQPLDDFQWGSNSDVLNAAIIIANAYRLNPKPDYLIAVQQAADYVLGA
NATGFSFVTGYGHKTPMFIHHRQSEADGIDEPIPGLIAGGPNFGKQDVADGVVYPENAPP
MKSWVDQEPSYASNEICINWNSPLSYILGFLENESK
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagaaataaagtgcttggtgttgggttgttgaccctattgataattgggctgtgtata
ggttgtgctggcaagcagtttcctccagatgataatgaatactcagatcagattagatta
aaccaaattggttattaccctaatgcagttaaaaaagcagttattgttgaggtaaaagga
gcaactgattttagtatagtggataggaaaacgatgtattctgtttttgaaggaaaatta
tcagagcaaatttcatgggagctttcaggggagaaagtgcaaatagcaaattttagtgac
ttaaccaagacaggtaaatacattttgtatatagattgtttaggttattcctatcctttc
gaaataagaaataatgtgcttgaccaagtttttttaggttcggtgaaagcaatgtattat
caaagaatgagcacccctttagaggaggaatttgcaggtaaatggcatagaccaatggca
catcctgatgataatgtttcttatcatccttcaagcggcaggaatgaaggttttttaaat
tctccaggaggttggtatgatgcaggagactataacaaatatgtagttaatggtagcttt
cctttggggcaatttttgtcttttcatgaacaatacccaaatactttaaaagataatagt
ctaaatattccagagagtggaaacggtacaagtgactatttggatgaactcaaatatgag
atggattggttattgaccatgcaggatgatgatggaggcctctttcataaattaaccgca
ttgaactttcagggaatggtgatgccacatgaggcaactgcaaaacgttatgttgttggg
aaaggcaccgcagcttcccttgatttctctgcttgtgcggcaaaagcctatagggttttt
aaggagattgacgctaattatgcccataagtgtttagaagcctcgaagagagcatatgca
tgggctttagaaaatccggatgtggaatatttaaaccctgaaattgtatccacagggcaa
tatggggacaaagattttctcgatgaatggttttgggcaaatgctgaactttatatttca
acaggagagaatgaatatttaaaaaagctaactgaaagcgattttaattttgaatttgta
ccaggtgataactggactaaattcatgcgatttatgggaatgttcgcgctattggacaat
aaggaaaccttatcatctcagatttttgaaagccttaaaaaaggaattatattggaagca
gataaactcgtggaacgaagtaattctttggcgtattttcaaccacttgatgattttcaa
tgggggtcaaatagtgatgtcttgaatgctgctataattatcgcgaatgcatataggttg
aaccccaaaccagattatttaattgccgtacaacaagcagcggattatgttttgggagcg
aatgcaacaggttttagttttgtaacggggtatggtcataaaacgcccatgtttattcat
cataggcaaagtgaagcagacggtatagacgagccaataccagggttaatagcgggtggt
ccaaattttggtaagcaagatgtggcagacggagttgtttatcctgaaaatgcaccgcca
atgaaaagttgggttgatcaagaacccagttatgcgagtaatgagatttgtattaattgg
aattctccattgtcctatatacttgggtttttggaaaatgaatcaaaataa

DBGET integrated database retrieval system