KEGG   Maribacter sp. HTCC2170: FB2170_09866Help
Entry
FB2170_09866      CDS       T01306                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00010  Glycolysis / Gluconeogenesis
fbc00030  Pentose phosphate pathway
fbc00051  Fructose and mannose metabolism
fbc00052  Galactose metabolism
fbc00680  Methane metabolism
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01120  Microbial metabolism in diverse environments
fbc01130  Biosynthesis of antibiotics
fbc01200  Carbon metabolism
fbc01230  Biosynthesis of amino acids
fbc03018  RNA degradation
Module
fbc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FB2170_09866
   00030 Pentose phosphate pathway
    FB2170_09866
   00051 Fructose and mannose metabolism
    FB2170_09866
   00052 Galactose metabolism
    FB2170_09866
  Energy metabolism
   00680 Methane metabolism
    FB2170_09866
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FB2170_09866
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FB2170_09866
Protein phosphatases and associated proteins [BR:fbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FB2170_09866
Messenger RNA biogenesis [BR:fbc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FB2170_09866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase MYO10_CC DAGK_cat
Motif
Other DBs
NCBI-ProteinID: EAR01069
UniProt: A4ASY4
Position
2490211..2491197
Genome map
AA seq 328 aa AA seqDB search
MNSKIKKIGVFTSGGDSPGMNAAIRSVVRTCAYLNIDCVGIYRGYQGMIDGDFKPMDARS
VNNIINKGGTILKSARCQEFRTKEGRQRAYEQLCAEGIDAFVVIGGDGSFTGAMIFNQEF
NFPVIGIPGTIDNDIFGTTFTLGFDTALNTVVEAIDKIRDTASSHNRLFFVEVMGRDVGH
IALNAGVGAGAEEILIPEENLGLERLIESLKRSKESGKSSSIVIVAEGDKTGKNIFELKD
YVEEHFPVYDVRVSVLGHMQRGGAPSCYDRVLASRMGVKAVEALLEGKTNLMVGVQDNKL
TLTAINKAIKGHTKIDKELIRVSDIMTI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcaagataaaaaagattggtgtgtttacatcggggggcgactctccaggaatg
aatgccgctattcgttcagttgtacgaacatgtgcttacttgaatattgactgtgttggt
atttatagagggtatcaaggaatgatagatggcgattttaagccaatggatgctagaagt
gtaaataatatcatcaataagggcggtaccatccttaaatctgcaagatgtcaagaattt
agaacgaaagagggcaggcaaagggcttatgaacaattatgtgctgaaggaattgatgct
tttgttgtgattggtggagatggaagttttaccggggcaatgatttttaatcaagaattc
aactttcctgttattggtattcctggtacaattgacaatgatatttttggaacaacattt
actttaggctttgataccgccttgaatacagtagttgaagctattgataaaatcagggac
acagcaagttcccataatagattgttctttgttgaggttatgggccgtgatgtgggtcat
attgcactcaacgctggagttggtgcaggagcagaggaaatattgattcctgaagaaaac
cttgggctggaacgtttgattgaatcattgaaaagaagtaaagaatctggcaaatcttcc
agtattgtaatagtcgctgaaggagataaaacaggtaaaaatatttttgaactcaaggat
tatgttgaagagcactttccagtatatgatgttcgcgtttccgttcttggacatatgcaa
agaggaggagcaccttcttgctatgatagggtgttggcaagcagaatgggtgtaaaggcg
gttgaggcattgctcgaaggaaagaccaatttaatggtaggtgtacaagataataagctt
acactgacagctattaacaaagctattaaagggcatacaaaaattgataaagaacttatt
agagtttcagatataatgacaatttaa

DBGET integrated database retrieval system