KEGG   Maribacter sp. HTCC2170: FB2170_09866Help
Entry
FB2170_09866      CDS       T01306                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FB2170_09866
   01230 Biosynthesis of amino acids
    FB2170_09866
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FB2170_09866
   00030 Pentose phosphate pathway
    FB2170_09866
   00051 Fructose and mannose metabolism
    FB2170_09866
   00052 Galactose metabolism
    FB2170_09866
  Energy metabolism
   00680 Methane metabolism
    FB2170_09866
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FB2170_09866
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FB2170_09866
Protein phosphatases and associated proteins [BR:fbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FB2170_09866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2490211..2491197
Genome map
AA seq 328 aa AA seqDB search
MNSKIKKIGVFTSGGDSPGMNAAIRSVVRTCAYLNIDCVGIYRGYQGMIDGDFKPMDARS
VNNIINKGGTILKSARCQEFRTKEGRQRAYEQLCAEGIDAFVVIGGDGSFTGAMIFNQEF
NFPVIGIPGTIDNDIFGTTFTLGFDTALNTVVEAIDKIRDTASSHNRLFFVEVMGRDVGH
IALNAGVGAGAEEILIPEENLGLERLIESLKRSKESGKSSSIVIVAEGDKTGKNIFELKD
YVEEHFPVYDVRVSVLGHMQRGGAPSCYDRVLASRMGVKAVEALLEGKTNLMVGVQDNKL
TLTAINKAIKGHTKIDKELIRVSDIMTI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaatagcaagataaaaaagattggtgtgtttacatcggggggcgactctccaggaatg
aatgccgctattcgttcagttgtacgaacatgtgcttacttgaatattgactgtgttggt
atttatagagggtatcaaggaatgatagatggcgattttaagccaatggatgctagaagt
gtaaataatatcatcaataagggcggtaccatccttaaatctgcaagatgtcaagaattt
agaacgaaagagggcaggcaaagggcttatgaacaattatgtgctgaaggaattgatgct
tttgttgtgattggtggagatggaagttttaccggggcaatgatttttaatcaagaattc
aactttcctgttattggtattcctggtacaattgacaatgatatttttggaacaacattt
actttaggctttgataccgccttgaatacagtagttgaagctattgataaaatcagggac
acagcaagttcccataatagattgttctttgttgaggttatgggccgtgatgtgggtcat
attgcactcaacgctggagttggtgcaggagcagaggaaatattgattcctgaagaaaac
cttgggctggaacgtttgattgaatcattgaaaagaagtaaagaatctggcaaatcttcc
agtattgtaatagtcgctgaaggagataaaacaggtaaaaatatttttgaactcaaggat
tatgttgaagagcactttccagtatatgatgttcgcgtttccgttcttggacatatgcaa
agaggaggagcaccttcttgctatgatagggtgttggcaagcagaatgggtgtaaaggcg
gttgaggcattgctcgaaggaaagaccaatttaatggtaggtgtacaagataataagctt
acactgacagctattaacaaagctattaaagggcatacaaaaattgataaagaacttatt
agagtttcagatataatgacaatttaa

DBGET integrated database retrieval system